(data stored in ACNUC9435 zone)

EMBL: CP000904.PE86

CP000904.PE86        Location/Qualifiers
FT   CDS_pept        128085..128357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btl:BALH_3118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5528"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46510"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV78"
FT                   /protein_id="ABY46510.1"
FT                   /translation="MKIKFDVVKNENFDFTLLETRLLKTFKEVDSEAIIEKVEDKIFEK
FT                   NDMQTHLVEITINVTGKNIGYRSVSASIFIVLESLSIKLFNISIH"
     atgaagatta aatttgatgt ggttaagaat gaaaattttg atttcacttt attagaaaca        60
     agattgctga aaacttttaa agaagtggat agtgaagcaa taattgaaaa ggttgaagat       120
     aaaatttttg aaaaaaatga tatgcaaacc catttagtgg agattactat taatgttaca       180
     ggaaagaata tcggatatag atcagtttca gctagtatat ttattgttct agaaagttta       240
     tcaataaagc tattcaatat tagtatacat taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page