(data stored in ACNUC9435 zone)

EMBL: CP000904.PE87

CP000904.PE87        Location/Qualifiers
FT   CDS_pept        129069..129431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5529"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bca:BCE_2526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5529"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46511"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV79"
FT                   /protein_id="ABY46511.1"
FT                   /translation="MKKIFALFAILTVFAVFSFGCDIRSLKLYGKDKYYVQIKGEGEIK
FT                   DKTRVYTLPAYDEEGAEKKISFTSHKAENDKKLKEDAFLRLYVSEDNDKSVDVKSYEEV
FT                   KKEDLPEKVKKKLNVK"
     atgaagaaaa tatttgcttt atttgctatt ttaacggtat ttgctgtttt ttcatttggt        60
     tgcgatataa ggagcttaaa gctctatggg aaagataaat attatgtaca aattaaaggt       120
     gaaggcgaaa taaaagacaa aacacgtgtt tacactttac cagcttatga tgaggaggga       180
     gcagaaaaga aaattagctt tactagtcac aaagcggaaa acgataaaaa acttaaagaa       240
     gatgcatttt tacgtcttta tgttagtgaa gataacgata aatctgtaga tgtaaaatct       300
     tatgaagaag tcaaaaaaga agatttgcct gagaaagtta agaagaaact taacgtaaaa       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page