(data stored in ACNUC9435 zone)

EMBL: CP000904.PE88

CP000904.PE88        Location/Qualifiers
FT   CDS_pept        130743..131816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5530"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bcz:pE33L466_0018
FT                   tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5530"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46512"
FT                   /db_xref="GOA:A9VV80"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV80"
FT                   /protein_id="ABY46512.1"
FT                   /translation="MDYSKQRQKSVHRKKLYENLNEMPFYIEEFVEYKELHDASPSTLL
FT                   NYVYDFRVFFNWLLSEQIIEFKPIKDISFSDLENLKKKDVENFMRFLKLQQNMQNSSVN
FT                   RKISALKSLFKYLTSLSENDDGECYFYRNVMAKIEIHKDKETLNARAKRMRSKIFHNDD
FT                   DQEFLNYIKYEHEKSLTKHQLFYFLRDKDRDVAILSLFLGSGIRVSELADLRMEDINLK
FT                   ERLIDVIRKGNKEDSVWITPIALNDLEKYMEIRDKKYAPGKELKNVFLSKYKHTAQPLS
FT                   VRAIQDIVEKYTKAFGKRMSPHKLRHTLANKLYMEEKDSLQVMQQLGHTSQDTALLYTQ
FT                   LGETTIKDSLGRIGKNK"
     atggattaca gcaagcaacg tcaaaaatca gtacatcgta agaaattata cgagaattta        60
     aatgaaatgc ccttttacat agaagaattt gtggagtaca aagaattgca tgatgcctct       120
     ccctccaccc tactgaatta tgtatatgat tttagagttt tctttaattg gctattatct       180
     gaacaaatta ttgaatttaa gcccattaaa gacatatcct tctctgattt ggagaattta       240
     aagaaaaaag atgttgagaa ctttatgagg tttttaaaac tacaacaaaa tatgcagaat       300
     tcctctgtta acagaaaaat ttcagcctta aagtctttat ttaagtacct tacctcccta       360
     tcagagaatg atgatggaga atgttatttt tatagaaatg taatggctaa aattgaaata       420
     cataaagata aggaaacatt aaatgcccgt gcaaaacgta tgagatctaa aatatttcat       480
     aatgatgatg atcaagagtt tttgaattac attaagtacg aacatgaaaa atctttaaca       540
     aaacatcagt tgttctattt cctaagagat aaagatcgtg atgtagctat tctttccctc       600
     tttcttggta gtggtattcg tgtaagtgaa ttggccgatc ttcgtatgga agatataaac       660
     ttaaaagaaa ggctaattga tgtaatacga aaaggaaaca aagaagattc tgtatggatt       720
     accccaattg cattgaatga tcttgaaaag tatatggaaa ttagagataa aaaatatgct       780
     ccagggaaag aattaaaaaa tgtattttta tcgaagtata aacatactgc acagcctctt       840
     tcggttaggg ctattcaaga tatagtagaa aaatatacta aggcctttgg taaaagaatg       900
     tctcctcata aattaagaca tacattggca aataagttat atatggaaga aaaagactcg       960
     ttacaagtga tgcagcaact tgggcatact agccaagata cggccttatt atacacacag      1020
     cttggagaaa caactattaa agatagctta ggtagaatag gaaagaataa ataa            1074
//

If you have problems or comments...

PBIL Back to PBIL home page