(data stored in ACNUC9435 zone)

EMBL: CP000904.PE89

CP000904.PE89        Location/Qualifiers
FT   CDS_pept        complement(132101..133078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5531"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46513"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV81"
FT                   /protein_id="ABY46513.1"
FT                   /translation="MDYKMIAKIYNINVTATLNKGKLIDDQNMRLSNSLATFNRFFNNE
FT                   AFTHAIGFLEFESLQNSIYMYQSGGLKQLQETFKSHSIKGEANYYYINSFLRKIDIFMV
FT                   ALWLVKDHSVNIETGFIVTGTNKNVYSVTSSNTAFLSSKSNGLINDTMFTIEEINEAIQ
FT                   YYKLLHPEINPNIGNQIADGLYKVKSLRVPRAFYFLQAARHETDVPVKIMKYCTILECL
FT                   FTTGRDEITHKISERFAKLMSEQLEQREYYFSLVKKSYAIRSTVIHGQSMSEKRYADAL
FT                   ELAIELDNAIRELLLKIILNSDFEKNFEQNEEDLERWFRKLILS"
     ttggattata aaatgattgc aaaaatctat aatattaatg ttactgccac tctaaataaa        60
     gggaaattaa ttgatgatca gaatatgaga ttatctaata gtttggcgac atttaatcga       120
     ttttttaata atgaagcatt tactcatgca atcggctttc ttgaatttga atctttacaa       180
     aatagtatat atatgtatca aagcggagga ttgaagcagc ttcaagaaac ttttaagagt       240
     catagtatta agggtgaagc aaattattat tacattaact cttttttaag aaaaattgat       300
     atatttatgg tagcattatg gctagttaaa gatcatagtg taaatataga aacaggattt       360
     atagtaactg gtacaaataa gaatgtttat tctgttacaa gtagtaatac tgcattttta       420
     tcctctaaat caaatggatt aattaatgat actatgttta ctatagagga aataaatgag       480
     gctattcaat attataaact tttacatccg gaaattaacc ctaatattgg gaatcagata       540
     gctgatggcc tatataaagt taagtcatta agagtaccac gagcttttta ttttcttcag       600
     gctgcaaggc atgaaacgga tgttcctgtg aaaataatga aatattgtac aattttagag       660
     tgtttattta caactggtcg tgacgagatt acacataaaa tttcagaacg gtttgctaaa       720
     ctaatgtctg aacaattgga acaaagagag tattacttct cgttagtgaa aaagtcttat       780
     gccattcgtt ccactgtaat ccatggacag tctatgtcag aaaaaagata tgcagatgcc       840
     ctcgaacttg ctatagagtt agataatgca attagagaac tattgctaaa gattatatta       900
     aatagtgatt ttgaaaaaaa ttttgaacag aatgaagaag atttagaaag atggtttaga       960
     aaattgattc tttcataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page