(data stored in ACNUC9435 zone)

EMBL: CP000904.PE9

CP000904.PE9         Location/Qualifiers
FT   CDS_pept        21064..27585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5441"
FT                   /product="Carbohydrate-binding CenC domain protein"
FT                   /note="PFAM: Carbohydrate-binding CenC domain protein;
FT                   KEGG: cpf:CPF_0969 KID repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5441"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46433"
FT                   /db_xref="GOA:A9VV01"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV01"
FT                   /protein_id="ABY46433.1"
FT                   /translation="MKGREYMPYAVGQITIVDLNDAIRSGTAPKNPVDGMLWIDTSVTP
FT                   NILKSWNAVSNKWVEQTLSIGGLDPNFDKDVQNLKKFVTDASNDGIIQTSEKLNVKLLL
FT                   VEITGDILAGTTLPTLATIDTAKGGQVYLARAEARAAGIPITHADYTAFETSYNDLKTY
FT                   LESLSPRPWQTGNTTIVPATWTSKWDLYYDKLTKLAVTTSTYLANSIKPGEDYNGVTIN
FT                   TDKGIVVLRGDNLFRTILNATEGISIEKNNAGTWNKMFYTNLDGKIYANGLVISSDSTI
FT                   AGTDANTIKNNAAAGKAGIDDLTNDLKVTPSEKTTLSREWESIKAEYTQVLAQATSLGV
FT                   TTATYTTSYTNLDGVTPKIAAEVLASMTSTYTFASASTRDAFRAKINTYFTESEKIKKA
FT                   INDAINESANNANDKIDNLKIGSRNIVRKKQVIPINAASTSYDEATNTWTLTANDGAGG
FT                   AWGAGVRITDKFSVIPIGSWYTASFEVYSPVDITWNNDTNNFPIGTSSGTNDNDEVALR
FT                   KNSGRNIKANVWTKCWFSYKNKDNSTTELYDQSNIGIVNNTGAPITFKIRNVKGELGSI
FT                   PTDFTSAPEDVDEMIANISFSGRNLLLDSNTDFSTTGYLINIYKLSEDWIVGQEYTFVI
FT                   KGTVPAGQRLGVWQNGGSNNMGYATTTYVNGVTYVTFKAIAPTSGQERTLSLYNYPSNT
FT                   TLSNVDWVALYKGNKPMDWMIAPEDIESIVKLQSSGAANMFRNSGSFKNLNGWILNAGK
FT                   SLNIAEKDGFTVLEAVGSITSTNHVTRNVLKPSTEYVYSVEIMFSKDTNIDNTKPIHHW
FT                   FFDTGGNYNAVDSYTLISNDKVAKANTWTRVSIVFKTKATITDAAYFKAFVYDNVQLTD
FT                   DNKYWVKNVMFSETNRAVIWSPSLADIEEMVANVSVGGRNIFLNSGLQQGAKYWYSNQS
FT                   QTEIVNDGSEKAFKFITNSGVVNGGIYQRQGGVSTGSLPFEKDQDYTLSVLLKSSVSGQ
FT                   KMDVGAEGISLSLFTIGTEWKEYSFTFKGTGAGNGTIIFYTRSAPDNTQIFVKRMKLEK
FT                   GNKKTDYAAAPEDTDQAISEVKDSVADMTSDMKITPLEKQTLSRDWESIKSEYWQVLPQ
FT                   GQAISSVSTTAYSTAYTNLDSVSPKIASEVLANMNATYSFASTAARDLFRNQINKYSDE
FT                   AEKVKRAIAEATNDANRELAQAISTGKMMFTDPIFKNGANNIIAYNNTSGSAVTATRVS
FT                   KPSDAPTTSSSVMEIKTTGAASPGHGGYVQNFNARSGAKFLVRIIAKIPAGCTLNVASN
FT                   SMGTGYTDKILTSNKGTGKFEEYIRLITCGTTGTFSNGGHFYLTSGLTATPEAPITWQV
FT                   AFATAYDVGDADYTVIDNKDKWDSAANDVKQGQVVINSTFSDWPGSFPNGLGSWSGSTV
FT                   SKETTLTRTGNAMRFNVPADNSQIGTTILPSFFIPNLPNNKYYAVELDFMLVSGAITGA
FT                   CLLLDWNGMSPSRTSIHLSDVESAPVLGKWYTLRAVMKRPTDNVTGYTGLAGFLLANYS
FT                   GSTTNKVKNIVFDRLVFREPTQQEIDAYEITTIENGKTVIDGGKLKTNSVKAESVDARR
FT                   LRVTNNSGLVTLEITDTGEVTVNGKVSINSRTDFAEGFDPSKNDGGRNILLNSRFSTAD
FT                   MTSWTNWGAPSVRQVEDITDLPGFDKAVKFTTTANNQGLNQNVSVINGKTYTLSSYVKS
FT                   ASGQPVLQVYDGAGYPSVVMNSTDVGKNKWVKIYFVFTAKANNVRLDMGKSAGGTLGTY
FT                   WFTGVKLEEGDKSTGWNPANEDIDGLLGKVVAPNGEIKALDIASSMSITPGAIDVISSS
FT                   INLKGKVTFSSFASGWALDSKGNKISNSDQPDYDPKNPLYLDMDGNYRPLTDEKDFMSS
FT                   LFTKDDKTGVTVIDGNYIKTGTIQAKYANFRDVQVYNDQGQQTFRIDTNGNLSTSGTSQ
FT                   SIGYERQKKGWKIDADGSAEFNAATFRGDIELGYYNAPTNAFVVTGGLLSSVGGTGKDL
FT                   RFWAGANKSTAPFKVYSDGTLEATKGYFTGTFSGEVVVGNISIRDTPTKGDAKIILTDD
FT                   SKIQKVVLGESAVELNTKTTFGNFLTVDIDNQKLDFGANDFKIDYTNNTIKMKSFSLKG
FT                   TTALEFISDGSSGDDFVFKNVTGDTSVRVDGSFIARDDIEITNVLRMKKATDTGNKGID
FT                   YVFI"
     ttgaaagggc gtgaatatat gccatatgca gttggacaga ttactattgt ggacttaaac        60
     gatgcaattc gatcaggcac agcacctaaa aaccctgtcg atggaatgct ttggatagac       120
     acgagtgtga ctccaaatat attaaaaagc tggaatgcag tttctaataa atgggttgaa       180
     caaactttgt ctattggagg cctagatcca aacttcgata aagacgtaca aaacttaaaa       240
     aaattcgtta cagatgcatc taatgacgga attattcaaa ccagtgaaaa actaaatgta       300
     aaattacttt tagtagaaat cacaggtgat atacttgctg gaactactct gcctacactt       360
     gcaacaatcg ataccgcaaa gggaggacaa gtttatttag caagagctga agcaagagcc       420
     gctggtatcc caataactca tgcagattat acagctttcg aaacatcgta caacgattta       480
     aaaacttatt tagaatcact ttctcctaga ccgtggcaaa cagggaatac aacaattgta       540
     cctgccactt ggacatctaa atgggatttg tactatgaca agcttactaa attagcagtc       600
     actacatcta cgtatctagc aaatagcatt aagcctggag aagattataa cggtgtcact       660
     attaacactg ataaggggat agttgttctt agaggtgata atcttttcag aacaatcctt       720
     aatgcaactg aaggtatctc tattgaaaag aacaatgcag gtacatggaa caagatgttc       780
     tatacaaacc tagacggtaa aatttatgca aacggattag ttattagctc tgactctaca       840
     attgcaggaa ctgatgcgaa tacaattaaa aacaatgctg cagctggtaa agcgggtatt       900
     gatgatttaa caaatgacct gaaggttact ccgtcagaga aaacaacatt aagtagagaa       960
     tgggaatcca ttaaagcaga gtacacacaa gtattagcac aagcaacttc tcttggtgtc      1020
     actactgcta cttatacaac atcttataca aatctagatg gcgtaactcc taagattgct      1080
     gctgaggtat tagcaagcat gacttctact tatacattcg cttcagcttc tacacgagat      1140
     gcatttagag caaaaataaa tacgtatttc actgagtcgg aaaagatcaa gaaagcaatc      1200
     aatgacgcga ttaatgaatc agcaaataat gctaatgaca aaatcgacaa tctcaaaatt      1260
     ggttcgcgaa acatcgtcag aaagaaacaa gtaattccta ttaatgcagc atctacatct      1320
     tatgacgaag ctacaaatac atggacacta acagctaatg atggagctgg cggagcatgg      1380
     ggagcaggtg tacgaatcac tgataagttt tctgttatcc ctatcggaag ttggtataca      1440
     gctagttttg aagtatattc acctgttgat atcacttgga ataacgatac aaacaacttc      1500
     ccaattggta catcatctgg cactaatgac aacgacgaag ttgcgttaag gaaaaattct      1560
     ggtagaaaca taaaagcgaa tgtatggact aagtgttggt tctcttataa aaacaaagac      1620
     aattccacaa ccgagctata tgaccaatct aatattggaa tcgttaataa cactggtgct      1680
     cctatcacgt ttaaaatccg aaatgtaaaa ggggagcttg gaagcattcc tactgacttt      1740
     acatccgctc cggaagacgt tgatgaaatg attgccaaca tttcctttag tggtagaaac      1800
     ctgttactag actctaatac cgacttctca actacaggat atcttatcaa tatatacaag      1860
     ttgtcagaag attggattgt agggcaagag tatacatttg ttattaaagg aactgttcct      1920
     gcaggacaaa ggttaggtgt ctggcaaaat ggtggttcta acaacatggg ttatgcaaca      1980
     actacatacg taaatggtgt aacctacgta acattcaagg caatagctcc aacgagtgga      2040
     caagaaagaa ctttgagctt gtacaactat cctagtaata caacactatc aaatgttgac      2100
     tgggttgctt tatataaagg taacaaaccg atggattgga tgattgctcc ggaagatatt      2160
     gagagcatag ttaaacttca atcaagcggc gcggcgaata tgtttagaaa ctctggtagc      2220
     ttcaagaatc ttaatggttg gatattgaat gcgggtaaat cattaaacat agcagagaaa      2280
     gatggattca cagttttaga agctgttggt tctattacat ctactaatca tgttactcgt      2340
     aatgtactaa agccatcaac tgagtatgtt tattctgtag aaatcatgtt tagcaaagat      2400
     accaatatcg acaacaccaa acctatacat cactggttct ttgatacggg tggaaactac      2460
     aatgcggtag attcctatac cctgatatcg aatgacaaag ttgcaaaagc taacacatgg      2520
     actagagtgt ctatcgtgtt taaaacaaaa gctactataa cggatgcagc gtactttaaa      2580
     gcatttgtat acgataatgt gcaactaaca gacgataata agtattgggt taaaaacgtt      2640
     atgttctctg agacaaacag agctgttatc tggtcaccat ccctagcaga tattgaagag      2700
     atggttgcaa atgtttcagt tggaggacga aatatattcc tgaactcggg tcttcaacaa      2760
     ggtgcgaagt attggtattc gaatcaaagt caaaccgaga ttgtcaatga tggcagtgaa      2820
     aaagctttta aatttattac taattccggt gtagtgaatg gaggaatcta ccaaagacaa      2880
     ggtggagttt caactggttc attaccattt gaaaaagatc aggactatac actaagtgtt      2940
     ctccttaaat caagtgtaag tggtcagaag atggatgttg gtgctgaagg aatcagtctc      3000
     tcattattta ctattggaac cgaatggaaa gaatattcat tcacctttaa aggtacagga      3060
     gcagggaacg ggacaatcat cttctacaca agatcagctc ctgataacac acaaatcttc      3120
     gtgaagcgaa tgaaattaga aaaaggtaac aagaagacgg attacgcagc tgctccagaa      3180
     gataccgatc aagcaatttc agaagtaaaa gactctgttg ctgacatgac aagtgatatg      3240
     aaaatcacac cgttagaaaa acaaacgcta agtcgtgatt gggaatctat aaaatcagaa      3300
     tactggcaag tacttccaca gggtcaagct atctctagtg tttctacaac agcatattca      3360
     actgcttata ccaacttaga tagcgtatct ccgaaaatcg cctcagaagt tttagctaat      3420
     atgaacgcca catattcatt cgcttcaaca gcagctaggg atttgtttag aaatcagatt      3480
     aataagtatt ccgatgaagc agaaaaagta aaaagagcta ttgcagaagc tacaaatgat      3540
     gcaaacagag agttagcgca agctatttca accgggaaga tgatgtttac tgacccgata      3600
     ttcaagaacg gtgcaaataa cataatcgct tataacaata ctagtggtag tgcagtaaca      3660
     gcgactaggg tttctaaacc atcagatgct ccaacaacat cttctagtgt gatggagata      3720
     aaaacaactg gagcagcatc tcctggtcat ggtggatatg tacaaaattt caatgcaaga      3780
     tctggtgcta aattcttagt tcgaatcata gctaaaatac cagcaggatg taccctgaac      3840
     gtagcttcta attcaatggg tactgggtat acggacaaaa tcctaacatc taacaaagga      3900
     acaggaaaat ttgaagaata tattcgtctt attacttgtg gaactacagg aaccttttcg      3960
     aatggaggac acttctattt aactagtgga ttaacagcta caccagaagc accgataact      4020
     tggcaagttg cctttgcaac tgcatacgat gtgggagatg ctgactatac tgtcattgat      4080
     aacaaggata aatgggatag tgctgcaaat gatgtaaaac aaggacaggt agttataaac      4140
     tcaacgttct cagactggcc cggttcgttt ccaaatggac ttggttcatg gtctggttca      4200
     acagtttcaa aagaaacaac cctaacaaga accgggaacg caatgagatt taatgttccg      4260
     gcagataatt cacagatagg tactactata ttacctagtt tctttattcc aaacctacct      4320
     aacaataagt attatgcagt tgagttggac tttatgttgg ttagtggggc aattacagga      4380
     gcgtgtttat tactggattg gaatggaatg agtccttcta gaacatcaat ccatctctct      4440
     gatgtggaat ctgctccagt tttaggtaag tggtatacgc ttcgggctgt aatgaaacga      4500
     ccaacggaca atgtaactgg gtacacagga ttggcagggt tcctccttgc taactactcg      4560
     ggttctacaa caaacaaggt taagaacatt gtctttgacc gacttgtttt tagagaacct      4620
     acacaacaag aaatagatgc ttatgagatt acaactatag agaatggtaa aacagttatt      4680
     gatggtggaa aactcaaaac aaattctgta aaagcggaat cagttgatgc aagacgtcta      4740
     cgcgttacaa acaacagtgg tttggttaca ttagaaatca cagatacagg ggaagtaact      4800
     gtaaatggta aagtctctat taacagtaga accgactttg ctgagggatt tgacccatca      4860
     aagaatgatg gtggacgaaa cattctttta aactctcgtt tctctactgc agacatgaca      4920
     agttggacaa actggggagc tccttctgta agacaagtag aagatattac ggacttgcct      4980
     ggttttgata aagccgttaa gtttacaaca acagctaata accaaggatt gaaccaaaac      5040
     gtatcggtta taaatggtaa gacatacact ctttcttctt atgttaaatc agcctctgga      5100
     caaccggttc ttcaggtata tgacggtgcg ggttatcctt ctgtagttat gaactcaact      5160
     gatgttggta aaaacaaatg ggttaaaata tactttgtgt tcaccgctaa agctaacaat      5220
     gtacgattag acatgggtaa gagcgctggg ggaacattag gaacttattg gtttactggt      5280
     gttaaattag aagagggcga caaatcgaca ggttggaatc cggctaatga agatatagat      5340
     gggttacttg gcaaagtagt agctccaaac ggagagatta aagcacttga tattgcttct      5400
     tctatgtcta ttacaccagg agctattgat gtcataagtt caagcatcaa cttaaaaggt      5460
     aaagtaacat tttcttcttt tgcttccgga tgggcacttg attcaaaagg aaacaagata      5520
     agcaactctg atcaaccaga ttacgatcct aaaaacccac tttatctaga tatggatggt      5580
     aactacagac cgttaacaga tgagaaagat ttcatgtcta gtctgttcac taaagacgac      5640
     aaaacgggag ttacagttat cgatggtaac tacattaaga caggaacaat ccaagcgaaa      5700
     tacgccaact ttagagatgt tcaagtatat aacgaccaag ggcaacaaac tttccgcatt      5760
     gatactaacg gtaatctatc tacatctggt acctctcaat ctatcggata tgaaagacag      5820
     aaaaaaggtt ggaaaattga tgctgatggt agtgctgaat tcaatgctgc tacattccgt      5880
     ggagatattg aattaggtta ttacaacgca ccgactaatg cttttgtcgt tactggtgga      5940
     ttattaagta gtgttggtgg aactggtaag gatttaagat tctgggcagg agctaataaa      6000
     tctactgctc cattcaaggt ttactcagat ggaactttag aggctactaa aggttacttc      6060
     acaggaactt tctctggtga agtggttgta gggaatatct cgattagaga tacaccaaca      6120
     aaaggagatg caaaaatcat tcttactgat gactctaaaa tacagaaagt tgtactaggt      6180
     gaatcagcag tagaattaaa tacaaaaacg acttttggta acttcttaac ggtagatatc      6240
     gataatcaaa aacttgattt tggagcaaat gatttcaaaa tcgattacac aaataacacg      6300
     attaaaatga aaagcttctc tcttaagggg acgacagctt tagagtttat atctgatggc      6360
     tcatctgggg atgatttcgt atttaaaaac gttaccggtg atacatcagt tcgagtggat      6420
     ggtagcttta ttgctaggga tgatattgaa atcacgaatg tcttacgtat gaaaaaggct      6480
     acagacaccg gcaataaagg tatcgattat gtattcattt aa                         6522
//

If you have problems or comments...

PBIL Back to PBIL home page