(data stored in ACNUC9435 zone)

EMBL: CP000904.PE90

CP000904.PE90        Location/Qualifiers
FT   CDS_pept        133250..134356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5532"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: baa:BXA0200
FT                   integrase/recombinase, phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5532"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46514"
FT                   /db_xref="GOA:A9VV82"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV82"
FT                   /protein_id="ABY46514.1"
FT                   /translation="MSNREKQVYQARVERHKEKMPWYIIEYIEEKTNLSPATLYGYLIE
FT                   YEMFLQWLISSRLAVADGEVVTKIHEVPIDTLEHLPLKQVKRFKSYLERQGNKTKAVIR
FT                   TFSALKSLFYYLTSNTEDDNGECYFYRNVMAKMEIHKEKIDAAARAKEISEVIFHNNDD
FT                   IKFMRFLSNEYEQMLQENAPGKLRFFKRDRERDIAILSLILGTGLRVSEAASLTISSVN
FT                   FRTRYIKVVRKGDKKSAILATQTALDDVQEYLKVRAVRYKCPEDEDILFVTNYKGSYAQ
FT                   ISVNAIQKFTEKYTRAFDEKKSPHKLRHTYATNHYNENKDLVLLANQMGHNSMETTSLY
FT                   TNIDDTKRRAAIERLEQRQLEENDEIDT"
     ttgagcaatc gagaaaaaca agtgtatcaa gcacgtgtag aacgtcataa agaaaaaatg        60
     ccttggtata tcattgaata tattgaagag aaaacgaacc tctcccctgc tactttgtat       120
     ggatacttaa ttgaatatga aatgttttta caatggttaa tctcctctcg tcttgccgtc       180
     gcagatggag aagttgttac gaaaatacat gaggtaccaa ttgacacatt ggaacatctt       240
     cctcttaaac aagtaaaaag atttaaaagt tatttagaga gacaaggtaa taaaacaaag       300
     gcagttattc gaacattttc agctctaaaa tcattatttt actacctaac gagcaacact       360
     gaagatgata atggagaatg ttacttttat agaaatgtta tggccaaaat ggaaattcat       420
     aaggaaaaaa ttgacgctgc agcaagagca aaagaaattt ctgaagttat tttccacaat       480
     aatgatgaca ttaaatttat gcgcttttta tctaatgaat atgagcaaat gctgcaagaa       540
     aatgctcctg gtaagttaag attctttaaa cgcgatagag agcgtgatat tgctattcta       600
     agtttaatct taggtacagg ccttcgggtc tcagaagcgg ctagtttaac tatttctagt       660
     gttaattttc gtactcgtta tattaaagtc gtacgcaaag gagataaaaa atcagctatt       720
     ttagcaacac aaacagccct tgatgatgtt caagaatatc ttaaagtacg tgctgttcgt       780
     tacaagtgtc ctgaagatga agacattcta tttgtaacga attataaagg ctcatacgcg       840
     caaatttctg ttaatgcaat acaaaagttt acagagaaat atactagagc atttgacgaa       900
     aaaaagagcc ctcacaagtt acgtcataca tatgcgacta atcattataa tgaaaataaa       960
     gatttggttc tgttagcaaa tcaaatgggg cataattcga tggaaactac ctctctttat      1020
     acgaatattg atgatactaa acgtcgagct gcaattgagc gtttagaaca acgtcaatta      1080
     gaagaaaatg atgaaattga tacatga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page