(data stored in ACNUC9435 zone)

EMBL: CP000904.PE91

CP000904.PE91        Location/Qualifiers
FT   CDS_pept        complement(135175..135591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5533"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain; KEGG: lwe:lwe1922 secreted
FT                   thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5533"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46515"
FT                   /db_xref="GOA:A9VV83"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV83"
FT                   /protein_id="ABY46515.1"
FT                   /translation="MIILCFVIIMLIFYMGSTKSSANSSSSFNPISTQKFEELIKEKEN
FT                   VWVYIGRPTCDDCDRFSPVLKEVIKENNKQVYYYNTDEARKENEEKLINHLNKLGVKSV
FT                   PTLIYFKKGEVVKTVVGYQDKASVEKLLKDYESR"
     atgatcatac tttgtttcgt aataatcatg ttaatttttt atatgggatc aacaaagtct        60
     tcagcaaatt cttcaagctc ttttaaccct ataagcactc aaaagtttga ggagcttata       120
     aaagaaaaag aaaacgtttg ggtatatatt ggccgaccaa cttgtgatga ttgcgataga       180
     ttttctcctg ttttgaaaga ggttattaaa gaaaataata aacaagttta ttactataat       240
     actgatgaag caagaaaaga aaacgaagaa aaattaatta atcaccttaa taaattagga       300
     gttaaatcag ttccaactct tatctatttt aaaaagggag aagttgtaaa aactgttgtc       360
     ggttatcaag ataaggcgag cgtagaaaag ttgctaaaag attatgaatc tcgataa          417
//

If you have problems or comments...

PBIL Back to PBIL home page