(data stored in ACNUC9435 zone)

EMBL: CP000904.PE92

CP000904.PE92        Location/Qualifiers
FT   CDS_pept        complement(135777..136523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5534"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46516"
FT                   /db_xref="GOA:A9VV84"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV84"
FT                   /protein_id="ABY46516.1"
FT                   /translation="MLVIKILANKYEIKGEIYVSLMKKFAAVAMASTLFFGWSGSSTFA
FT                   SPNTESVSKNVSVNQNKDMKSTFKKMNDLANTTKVIQDSQRIQDIKITAENSISSGKVV
FT                   LNHSDAQLDFDNAKYLDISQDNKSYKSITIPIVGDQYNLISNLTVIFDSQDKISNYSET
FT                   LITKSENNKFVITSYSDGELVQNQVTDVDYKSNSEVKKSLDRINAQAINVDAPQYSMGA
FT                   VAACIAAVATMGAGSIAGVIACFNKL"
     atgcttgtca taaaaatact agcgaataaa tacgaaataa agggagagat ttatgtgagt        60
     ttaatgaaga aatttgctgc agtcgcaatg gcttcaacac tatttttcgg atggtctggt       120
     agttcaacgt ttgcatcacc aaatactgag tcagttagta aaaatgtaag tgttaatcaa       180
     aataaagata tgaaatcgac ctttaaaaaa atgaatgatc ttgcaaacac tacaaaggta       240
     atacaggatt ctcaaagaat tcaagatata aaaatcactg cggaaaattc tatttctagt       300
     gggaaagtag ttctgaatca ttcagatgct cagttggatt ttgataacgc aaagtattta       360
     gatatttcac aggataataa gagctataaa tctattacta ttccgattgt aggagaccaa       420
     tataacttga taagtaattt aactgtaatc tttgattcgc aagataaaat ttctaattat       480
     tcagagactt taattacaaa gagtgagaac aataaatttg taattacttc ttactcagat       540
     ggagaattag tacaaaatca agtaactgat gtggattata aaagtaacag tgaagtgaaa       600
     aaatcattag atcgtataaa tgcacaagcg attaatgtag atgctccaca gtatagtatg       660
     ggtgcagtag cagcttgtat tgctgccgtt gctactatgg gtgcgggttc tatcgctggt       720
     gttatagctt gttttaataa gttgtaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page