(data stored in ACNUC9435 zone)

EMBL: CP000904.PE93

CP000904.PE93        Location/Qualifiers
FT   CDS_pept        complement(136527..136769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5535"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46517"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV85"
FT                   /protein_id="ABY46517.1"
FT                   /translation="MLAGHLDANGEPQAFKKSSATFEEARSIRCESSKPNWEEGDSGYL
FT                   KTKEGIQPVVVGKTTTQKTVLHIIGANKFVELTPI"
     atgttagcgg ggcatctaga cgcaaatggt gaaccacagg cgtttaaaaa atcaagcgca        60
     acctttgaag aggctagaag tattcgatgt gaatcttcaa agccaaattg ggaagaaggc       120
     gacagtggat atttgaaaac taaggaaggg attcagccag tagttgttgg aaaaacaacc       180
     acacaaaaaa cagtattaca tattattgga gctaataaat ttgtagaact aacgccaata       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page