(data stored in ACNUC9435 zone)

EMBL: CP000904.PE94

CP000904.PE94        Location/Qualifiers
FT   CDS_pept        complement(136775..137020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5536"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46518"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV86"
FT                   /protein_id="ABY46518.1"
FT                   /translation="MKSVTLSLAPTTFVVTGDKKEELLANAKKTFIEQVSKNLFPHIKY
FT                   SINDADALTMETSFPGLIVETEEGLKGIVTAIKGRP"
     ttgaaatcag taactttatc attagcacca actacttttg ttgtaacagg agataaaaag        60
     gaagaactgc ttgcgaatgc aaagaaaaca ttcattgagc aagtatcaaa aaatcttttc       120
     cctcacatta agtattctat taatgacgca gatgcattaa ctatggaaac aagtttccca       180
     gggttaattg tagaaacaga agagggcttg aaagggattg ttacagctat taaaggaaga       240
     ccatag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page