(data stored in ACNUC9435 zone)

EMBL: CP000904.PE95

CP000904.PE95        Location/Qualifiers
FT   CDS_pept        137305..137493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5537"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: bcz:pE33L466_0115 host
FT                   factor-I protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5537"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46519"
FT                   /db_xref="GOA:A9VV87"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV87"
FT                   /protein_id="ABY46519.1"
FT                   /translation="MHTLQEDMYEQLKEKKGEVTVFLKNGVPVRGQILATDKFTVLMMV
FT                   HGKQQLVYKQAISTIAM"
     atgcacactt tacaagaaga tatgtatgaa caattgaaag agaaaaaagg ggaagttacg        60
     gtatttttaa agaatggcgt tccagtacgt gggcagatcc ttgcaacaga taaattcacc       120
     gtcctaatga tggttcatgg taaacaacaa ctagtctata aacaagccat ttctacaatt       180
     gctatgtaa                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page