(data stored in ACNUC9435 zone)

EMBL: CP000904.PE96

CP000904.PE96        Location/Qualifiers
FT   CDS_pept        complement(137680..139626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5538"
FT                   /product="Delta endotoxin central region subgroup 1"
FT                   /note="PFAM: delta endotoxin domain protein; Delta
FT                   endotoxin central region subgroup 1; KEGG: reu:Reut_A0376
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5538"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46520"
FT                   /db_xref="GOA:A9VV88"
FT                   /db_xref="InterPro:IPR001178"
FT                   /db_xref="InterPro:IPR005638"
FT                   /db_xref="InterPro:IPR005639"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036399"
FT                   /db_xref="InterPro:IPR036716"
FT                   /db_xref="InterPro:IPR038979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV88"
FT                   /protein_id="ABY46520.1"
FT                   /translation="MNSNNKTNPNVIGTSSDQSLLTNSVKKTLANDQSNPLQHRDSNDC
FT                   LSVSEGNRDSLNHDVFISAPGLVDTTANITSAILSALGVPMLGTVVKLYSKLFGFLWGS
FT                   TPGQDPWKELMDRVEVLIDQKLTEYARSKALAELEGLQNVMKSYVDALESWQNNSRNSQ
FT                   TRLLVQQRLVVADSQFKQAMPSFAIKDYEVSLLPVYTQAANLHLLLLRDSQIFGKDWGM
FT                   PQHEIDLFYKEHLECIEKYSDHCVEWYHTGLNKLKSSTAKDWIDYNRFRREMTVAVLDI
FT                   VALLPKYDVHMYPMPIHAELTREIYTDPVGSYLPYKGNFKDVMSWYEMTKAYRQPTFQD
FT                   LENLILKPSRFTWLKDLKMYTRKRQNGKYEYYNYWVGHQLEKALIGEKYVRETTISGEI
FT                   TSEEDTFTFEDYDIHRVLCNYIGRYDNSLVGVNQVEFHYLDNNTPRKKEYKKDIRVTNQ
FT                   SQKIIDSEEELLSHRLSYVESFDLYWNHKNEKGGTIPVFGWTHHSVAPKNIIYEDKITV
FT                   ISATKASGYFTSEVIQGPGYSGGGLIKGSKSMGNIPLTPPRDAHNKNYRLRIRYAADSD
FT                   DLLKMTFTSGIGPAKYQTPYQATMKKGDSFKYNSFQYVEKVVTISSSINGINFSAGSGF
FT                   YLDKVEFIPVNEN"
     atgaattcga ataataaaac taaccctaat gtaataggca cttcatctga ccaatcttta        60
     ttaaccaact ctgtaaaaaa aactttagca aacgatcaaa gtaatccatt acaacatagg       120
     gattctaatg attgtttgag tgtgtcagag ggaaatagag attctctgaa tcatgatgtg       180
     tttattagtg ccccaggtct agttgatact acagctaata ttactagtgc tatactgagt       240
     gctttaggtg ttccgatgtt agggactgtt gttaaattat atagtaaatt atttggtttt       300
     ttatggggat caacgccagg acaagatcca tggaaagagc tgatggatcg agtggaagta       360
     ctcattgatc agaaattaac agaatacgca agaagtaaag cattagcaga attggaagga       420
     ttgcaaaatg taatgaagtc atatgtggat gcacttgaat catggcaaaa taattctcgg       480
     aattcacaaa caagattatt agtacaacag agattggttg ttgcagattc ccaatttaaa       540
     caggcaatgc cttcctttgc aattaaagat tatgaagttt cattattacc ggtatataca       600
     caagctgcaa atcttcattt acttttatta agagatagcc agattttcgg aaaagattgg       660
     ggaatgcctc aacatgaaat tgatcttttt tataaagaac acttagagtg catagaaaaa       720
     tattctgacc attgtgtgga atggtatcat actggcttaa ataaacttaa aagttcaact       780
     gctaaggatt ggattgacta caatcgtttc cgaagagaaa tgacagtggc agttttagat       840
     atcgttgctt tacttcctaa gtatgatgta catatgtatc caatgccaat acatgcagaa       900
     cttacacggg aaatttatac agatccagtg gggagttatt tgccctacaa aggtaatttc       960
     aaggatgtta tgtcttggta tgaaatgaca aaagcatatc gccaacctac atttcaagat      1020
     ttagaaaact taatcctaaa gcctagtcgg tttacttggc taaaagatct taagatgtat      1080
     acaaggaaaa gacaaaatgg gaaatatgag tattataatt attgggtagg acatcagtta      1140
     gagaaagcgt taattggtga aaaatacgta agagaaacaa caattagtgg tgaaattact      1200
     agtgaagaag atacatttac ttttgaagat tatgatattc atagggtttt atgcaattat      1260
     atagggagat acgataatag tttggtgggg gtaaaccaag ttgagtttca ttatcttgat      1320
     aacaatacac ctcggaagaa ggaatataaa aaagatatta gggttacgaa tcaatcacaa      1380
     aaaataattg actcagaaga ggaattactt agtcatagat taagttatgt tgaatctttt      1440
     gatttatatt ggaatcataa aaatgagaaa ggagggacaa tacctgtatt tggttggaca      1500
     catcatagtg tagcccctaa aaatataatt tatgaggata agattacagt aatctcagct      1560
     actaaagcta gtggttattt cacttctgaa gttatacaag gtcctggata ttcaggaggg      1620
     ggtttaataa aaggatctaa gagcatggga aatattccat taactccacc tcgtgatgca      1680
     cacaacaaaa attatcgttt gagaattcgc tatgccgctg attcagatga tttacttaaa      1740
     atgactttta cctctggtat tggaccagct aaatatcaaa cgccctatca agcaacaatg      1800
     aaaaaagggg attctttcaa atataattcc tttcaatatg tagaaaaagt agtaactatt      1860
     tcgtctagta taaacggcat aaacttcagt gcaggaagtg gtttttactt ggataaggtt      1920
     gaatttattc cagtgaatga aaattag                                          1947
//

If you have problems or comments...

PBIL Back to PBIL home page