(data stored in ACNUC9435 zone)

EMBL: CP000904.PE97

CP000904.PE97        Location/Qualifiers
FT   CDS_pept        complement(139780..141753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5539"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rme:Rmet_5415 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5539"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46521"
FT                   /db_xref="GOA:A9VV89"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV89"
FT                   /protein_id="ABY46521.1"
FT                   /translation="MKITQDPKDATNCTTLFNKQVAEDLNINSETEYALAIKNLVEPCE
FT                   ELVIMEDNKIIWSQKAYQFLEKDEWSSTVNPSLWCNGKNNHVSGLFKVTEEIYQVRGFD
FT                   MANMTMVLTPQKTWVMLDTLMSTECTIAALNFADTYFTKNNLPKLIGNIRAIIMSHSHV
FT                   DHFGGVNGIFTYEEQNPDIPIYAPKGFTEHAVSENIYAGNAMARRAAYQYGSFLDAGKK
FT                   GSISIGIGQTQSKGTISFRLPTHEITENQSIVIDDLKLTFQLTPGAEAPAEMNTHFPKY
FT                   RALWLAENCSGTLHNLYTLRGAQVRDGNAWGKYLLESISLFADETDVTFQAHNWPHWNT
FT                   DDSPNMVREHITVTAAAYKFINDQTLLYINQGYTSTEIADKIQLPTDLAKYWYIRPYYG
FT                   TPKHNAKAVYQKYMGWYDANPANLDPLPNVKRAEKLIDYMGGSDAVIEKSLIDFENGNY
FT                   QFVADIMSTLVFADPNNQKARFLAADALEQLGYQSESGIWRNAYLSGAYELRNGTVTDP
FT                   TKYVSGAEITEYMTGEMILDYLGILIDGDRCSHFSLEFNLIISDDIDLTEGSSEYHMRE
FT                   YILKLYQGTVLYFKDTSSSELPTVTMTRQQLLSLTAGSTPEKAKEIAESISDDPKVIDA
FT                   LVNFMSYITQLSEYRHFNIIEP"
     atgaagataa cacaagatcc aaaagatgca acgaattgta caacattatt taataaacaa        60
     gttgctgaag atttaaatat aaatagcgaa acggaatatg cattagctat taagaattta       120
     gttgaaccgt gtgaagagct agttattatg gaagataata aaatcatttg gagtcaaaaa       180
     gcctatcaat tcttagaaaa agacgagtgg tcttctacag tgaatccaag tctatggtgc       240
     aatgggaaaa ataatcatgt gagcggtttg tttaaagtaa ctgaggagat atatcaggtt       300
     agaggatttg atatggctaa tatgacaatg gttttaactc cccaaaaaac atgggttatg       360
     ttagatactt tgatgagcac agagtgcaca atagccgctt tgaattttgc agatacttat       420
     ttcacaaaaa ataatttacc aaaactgata ggtaatattc gtgcgataat tatgagtcat       480
     tcgcatgtcg atcattttgg aggggttaac ggtatattta catacgaaga gcaaaatccg       540
     gatatcccta tttatgctcc taaaggcttt actgagcatg ctgttagtga gaatatttac       600
     gcaggaaatg cgatggcacg tagagctgca tatcaatatg gttctttttt agatgctggt       660
     aaaaaagggt caatttctat aggtattggt cagacccaat caaaaggaac aattagtttt       720
     aggttaccta ctcatgaaat tacagagaat caatccattg ttattgatga tttaaaactt       780
     acttttcagt taactcctgg ggctgaagct ccagctgaga tgaatactca tttccccaaa       840
     tatagagcct tatggttagc agaaaattgt tcaggaacct tgcataactt atatacattg       900
     cgcggtgctc aagtgcgaga tggcaatgca tggggaaaat atttactcga atctatatcg       960
     ttattcgctg atgaaacaga tgtaacgttt caagcgcata attggccaca ttggaatacc      1020
     gatgattctc ctaatatggt tcgtgaacat ataacagtaa cagctgcagc atataagttt      1080
     attaatgatc aaacattact atatattaac caaggatata cgagtacaga aattgcagat      1140
     aaaattcaac tacctacaga tttagcgaaa tactggtata ttcgtccata ttatgggacg      1200
     ccaaaacata acgcaaaagc tgtatatcaa aagtatatgg gctggtatga tgcgaaccca      1260
     gcaaatttag atcctttgcc aaatgttaaa cgggcggaaa aattaattga ttatatgggt      1320
     ggaagtgatg cggtaattga aaaatcgtta attgattttg aaaatggtaa ttatcagttt      1380
     gttgcagata ttatgagtac gctagtattt gctgatccta acaatcaaaa ggctcgtttt      1440
     ttagctgccg atgctttaga gcaattgggg tatcaatctg aatcgggtat ttggagaaac      1500
     gcctatttat caggtgcgta tgaattaaga aatggaacag ttactgatcc aacgaagtat      1560
     gtttcaggag ctgaaataac tgaatatatg acaggagaaa tgattttaga ttatttaggt      1620
     attttaattg acggggatag atgttcacat ttttcccttg aatttaatct aattatttca      1680
     gatgatattg atttaactga aggatcaagt gaatatcaca tgagagaata cattttaaaa      1740
     ctctatcagg gaaccgtatt atattttaag gatacgtcat cgtcagaatt acctacagta      1800
     actatgacac gacaacaatt attatcactt acagcaggta gtacaccaga aaaagcaaaa      1860
     gaaattgctg aaagtatttc agatgatcca aaagtaatag atgcactggt gaactttatg      1920
     tcctatatca ctcaattatc agagtatcgt cattttaata ttattgaacc ataa            1974
//

If you have problems or comments...

PBIL Back to PBIL home page