(data stored in ACNUC9435 zone)

EMBL: CP000904.PE98

CP000904.PE98        Location/Qualifiers
FT   CDS_pept        141904..142812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5540"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: ssp:SSP2166
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5540"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46522"
FT                   /db_xref="GOA:A9VV90"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV90"
FT                   /protein_id="ABY46522.1"
FT                   /translation="MNIEQLKLIVTLSEERKLSRVAQKLNLTPSAVCQGIKNLEKELHT
FT                   TLFNRSKNGTYPTTEGLHVIKKAYEALKTIDEIVEYTTEKKDYPKLNMKIAIVPGVIPP
FT                   LVEAINELKMEFPFVEMEIIQGKTQHVLTSLQMGQVDFGLIMHSDNIQSKSIPYNIKKV
FT                   CNGEFHIAMSRNSKLALYNQIDYETLIKEPLALYQDEHILDYVRHIEKETGEYSNTLFV
FT                   TNNSNSIIYAVKNNFAITISPQFTFNNEYRNFYNDIKQVPIKVDENRQPFALWFVSSKR
FT                   TDSTEITDTFFQLIHHYVNAL"
     atgaatattg aacaattaaa attgatcgta accctctcag aagagagaaa actttcacgt        60
     gtagctcaaa aattaaacct cactccatct gcagtatgtc aaggaattaa aaacttagaa       120
     aaagaattac atacaacact gtttaacaga tctaaaaatg gaacatatcc aacaacagaa       180
     ggtttacatg ttataaaaaa ggcatatgaa gctttaaaaa ccatcgatga aattgttgaa       240
     tatacaacag aaaaaaaaga ttatcccaag ttaaacatga aaattgctat tgtgcccggt       300
     gtgattcctc cactggttga ggcaatcaac gaattaaaaa tggagtttcc ttttgttgag       360
     atggaaataa tccaaggaaa aacacagcac gtcctcacat ctttacaaat gggacaagtt       420
     gattttggat taataatgca ttctgataat atccaaagca aaagtatccc ttacaacatt       480
     aagaaagttt gtaatggtga atttcatatt gcgatgagta gaaattccaa acttgcatta       540
     tataaccaaa tcgattacga aacactaata aaagaaccgt tagcactcta ccaagatgaa       600
     catattcttg attatgtgag acatatagaa aaagagacgg gtgaatatag caatactttg       660
     tttgtaacaa ataattcaaa ttccattatt tatgctgtta aaaataattt tgcaatcacg       720
     atttcaccgc agttcacatt taacaatgaa tatagaaatt tttataatga tattaaacaa       780
     gttcctatca aagttgatga gaatcggcaa ccatttgcat tatggtttgt ttcttctaaa       840
     aggactgatt caactgaaat tacagatacc ttttttcaac tcattcatca ttatgtaaat       900
     gctttgtaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page