(data stored in ACNUC9435 zone)

EMBL: CP000904.PE99

CP000904.PE99        Location/Qualifiers
FT   CDS_pept        complement(144065..145450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_2868 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5541"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46523"
FT                   /db_xref="GOA:A9VV91"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV91"
FT                   /protein_id="ABY46523.1"
FT                   /translation="MYFIKKYHHFLITEYKVIIITGVLIFTKLIIVGRELNSMDILITI
FT                   LMFASISLLVYSLIQKIRKKPAIIWLKIAGISFGLALIISGFSVGVRGGFAAITFIIGA
FT                   CATVKLILQFVKKQSGKLKTFIVVLIAFTTYTILDNVIPYSTSVESSDGNVTSQKKPAV
FT                   DAGKVDAKEESREPTHKQYSTEEIKSLFTIGMSIKEFEEKKEDSKLKVRNYNNYDPAGL
FT                   YTFDTKDGQIVVVVLNAKEVIKVETLTDEASLGNFIKDEENRMNEEKRVAKEEADRKLK
FT                   ESYENNKQKLEGSGDSVTNKVNLKSGLAFFDFNNAGSRNFIIHLKDSSGKDVGLLVNTI
FT                   GSYKGKVSATIPASGEYYLEVKSSGDWNVAITQETPLVSESVPGTINGHGDDVVFINIP
FT                   SGNHIVKLKHTGSRNFIIKVNDQNLLVNKIGSYEGSSSHVFKDSGMYSFGVKADGDWSI
FT                   TIE"
     ttgtatttca taaaaaaata ccaccacttc cttattacag aatataaggt tattataata        60
     actggagtat taatatttac taagttaatt attgtaggga gagaacttaa tagtatggac       120
     attttgataa caattttaat gtttgcttca atcagtttat tagtatactc actaatacag       180
     aaaataagaa aaaaaccagc tatcatatgg ctgaaaattg ctggtatatc attcggtctt       240
     gctttaatca tatctggatt ttctgttgga gtaagaggtg gatttgccgc aataacgttt       300
     attattggag catgcgctac agtaaaacta attttacaat ttgtaaaaaa acaatccgga       360
     aaattaaaaa ctttcattgt ggttcttatt gcatttacca catataccat actagacaat       420
     gtaattccat atagtacaag tgttgaaagt agcgatggaa atgttacaag tcaaaagaaa       480
     cctgctgtag atgcggggaa agtagatgca aaagaagaat ctagagaacc tactcacaaa       540
     cagtatagca cggaagaaat taaatcattg tttactatcg gtatgagtat aaaggaattt       600
     gaagaaaaaa aagaagacag taagttaaaa gttcgaaact ataacaatta cgatccagct       660
     ggattataca catttgatac taaagatggg caaattgtag tagtggtatt aaatgcaaaa       720
     gaggttatta aagttgaaac gttaactgac gaagcttctt taggaaattt cattaaagat       780
     gaagaaaata gaatgaacga agaaaaaaga gttgcaaaag aagaagctga tagaaagcta       840
     aaagaatcat acgaaaataa taaacagaaa ttagaaggat ctggtgattc tgtcacaaat       900
     aaagttaatc taaagtcagg tttggctttt tttgatttta ataatgcagg ttcaagaaac       960
     tttataatac atttaaaaga ttctagtggc aaagatgttg gattgttagt aaatacaata      1020
     ggtagttata aagggaaggt atcagctacg attccggcta gtggagaata ttatttagaa      1080
     gtgaaatcga gtggcgattg gaatgtagca ataacgcaag aaacaccact tgtatcagaa      1140
     tcggttccag ggacaattaa cgggcatggt gatgatgtag tattcattaa tatcccaagt      1200
     ggaaatcata ttgttaagtt aaagcataca ggttcaagaa actttattat taaagtgaat      1260
     gatcagaatt tattagtgaa taaaattggt tcttatgaag gttcttcttc tcacgttttc      1320
     aaagattcag ggatgtatag ttttggagta aaagcagatg gagattggag cattacaata      1380
     gaatag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page