(data stored in ACNUC7421 zone)

EMBL: CP000947.PE1

CP000947.PE1         Location/Qualifiers
FT   CDS_pept        279..1646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0136 chromosomal replication initiator
FT                   protein, DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30707"
FT                   /db_xref="GOA:B0UUL8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUL8"
FT                   /protein_id="ACA30707.1"
FT                   /translation="MDKMSSTVSTLWRDCLSQLQDQVSSNDFTTWLRPLQDDVSESNMI
FT                   LYAPNCFIKGWVENHYLTQITKLAQQLLNNDQFMVKIQDGIKPTEKTTTNVEQKTQNEN
FT                   CHNEITSQQNYRSYLNKNHVFDNFVEGKSNQLARAVAQKVAKNPGEQSANPLFLYGGTG
FT                   LGKTHLLHAVGNGILANNPHAQVVYMHAERFMQSYVKALKSDRMDSFKRFYRTVDALLI
FT                   DDIQFFAGKDGTQEEFFHIFNSLFERGRQIILTSDRYPKEIEKIEDRLKSRFGWGISVA
FT                   IEPPELETRVAILLKKAEEKNMVLPEEVAMFIGGKLRTNVRELEGALNRVHAHAEFTGK
FT                   AITIDFVRETLKDMLALQDKLVTIENIQKIVADYYRIKISDLKSKRRSRNITRPRQLAM
FT                   ALAKELTNRSLPEIGRNFGDRDHTTVLHACKAIAKLREEDNGIQEDWSNLIRTLSV"
     atggataaaa tgagttcaac agtttctacg ctatggcgag attgcttatc acaattacaa        60
     gatcaagtat cttcaaatga ctttacgact tggctacgac cattacagga cgatgtcagt       120
     gagagtaaca tgatacttta tgcaccaaat tgtttcatta aaggatgggt tgaaaatcat       180
     tatctcactc aaatcacaaa gcttgctcag caattgttga ataatgatca attcatggta       240
     aagatacaag acggcataaa acctactgag aaaacaacaa cgaatgttga gcaaaagaca       300
     caaaatgaaa actgtcataa tgaaataact tcgcaacaaa attaccgctc ttatctcaat       360
     aaaaatcatg tctttgataa ctttgttgaa ggtaaatcca accaattggc acgagcagtt       420
     gcccagaaag tggctaaaaa tccgggtgag caaagtgcta atccattgtt tttgtatggt       480
     ggtacaggtc taggcaaaac gcacctgttg catgctgtag gaaacggcat tttagcaaat       540
     aatcctcatg ctcaagttgt ttatatgcat gcagaacgtt ttatgcaatc ttatgtaaaa       600
     gccttaaaat ccgatagaat ggacagtttt aagcgatttt atcgtactgt tgatgcctta       660
     ctgattgatg atattcaatt ttttgccggt aaagatggta cgcaagaaga atttttccat       720
     atattcaact cgttatttga gcgtggtcgc caaattattt tgacttctga tcgttatccg       780
     aaggaaattg agaaaattga agatcgttta aaatctcgtt tcggttgggg aattagtgtt       840
     gctattgaac ctcccgaatt ggaaaccaga gtcgcgattt tgttgaagaa agcggaagaa       900
     aaaaatatgg ttttacccga agaggttgcc atgtttattg ggggaaaatt acgtactaat       960
     gtgcgagaat tagaaggtgc attaaaccgt gttcatgcac atgcggaatt taccggaaaa      1020
     gcgattacca ttgattttgt acgtgaaact ctaaaagaca tgttggcatt gcaagataaa      1080
     ttggtaacaa ttgaaaatat tcaaaaaatt gtggcggatt attatcggat caaaatttcg      1140
     gatttaaaat caaaaagacg ctcacgtaat ataacccgac cacgtcaatt agctatggca      1200
     ttagctaaag aactaacgaa tcgcagtctt cctgaaattg gtaggaattt cggtgatcgg      1260
     gatcatacga ccgttctgca tgcttgtaag gccatagcaa aactccgaga agaagataat      1320
     ggtatccaag aagattggtc aaatttaatc cgcacactgt cagtataa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page