(data stored in ACNUC7421 zone)

EMBL: CP000947.PE100

CP000947.PE100       Location/Qualifiers
FT   CDS_pept        109076..110608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0100"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT domain protein; KEGG:
FT                   hso:HS_0232 NAD(P)(+) transhydrogenase, alpha subunit
FT                   (pyridine nucleotide transhydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30709"
FT                   /db_xref="GOA:B0UV58"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV58"
FT                   /protein_id="ACA30709.1"
FT                   /translation="MLIGVPRELLDNESRVAATPKTVQQILKLGFEVIVENNAGFNASF
FT                   EDQAFVNAGAKIGSAQDIWNADIIFKVNAPTDAEIAQIKEGATLISFIWPAQNSELMAK
FT                   LSSKKINVLAMDAVPRISRAQALDALSSMANISGYRAVIEAAHEFGSFFTGQITAAGKV
FT                   PPAKVLVIGAGVAGLAAIGAANSLGAIVRAFDSRPEVKEQVKSMGADFLEIDFQEEGGS
FT                   GDGYAKVMSEEFNRRAMALYAEQAKEVDIIITTAAIPGKPAPRLITKEMVDSMKPGSVI
FT                   VDLAALTGGNCDYTQAGEIVVTENQVKVIGYTDFPSRLPTQSSQLYGTNLVNLLKLLCK
FT                   EKDGNIHIDFEDVVLRGVTVIRDGEVTWPAPPIQVSAQTQQKITAPVVDKKEKTPINPK
FT                   VKYGVMALAGAAFLWLGSVMPAAFLSHFTVFVLACVVGYYVVWNVSHALHTPLMAVTNA
FT                   ISGIIIVGALLQIAQGNFFISLLAFIAILVAAINIFGGFKVTQRMLAMFRKG"
     atgttaattg gtgtacctag agaactgctt gataatgaaa gtcgtgtggc ggcaacgcca        60
     aaaacggttc aacaaatttt gaaacttggt tttgaagtga ttgttgagaa caatgccggt       120
     tttaatgcga gttttgaaga tcaggcgttt gtaaatgcag gcgcaaaaat tggttcggca       180
     caagatattt ggaatgcgga tattattttt aaagtaaatg caccgacaga tgctgaaatt       240
     gcacaaatta aagaaggtgc aacgcttatt agctttattt ggcctgctca aaattcagag       300
     ctaatggcaa aactttcttc taagaaaatt aatgtgttag caatggatgc tgtgcctcgc       360
     atttctcgtg ctcaagcctt agatgcgtta agttcaatgg caaatatttc cgggtatcgt       420
     gctgttattg aagctgcaca tgaatttggt agctttttta cagggcaaat tacagctgca       480
     ggtaaagtac ctcctgcgaa agtacttgtt attggtgcag gggttgcagg gcttgcagca       540
     atcggtgcag ctaatagttt aggtgcgatt gttcgtgcat ttgattcccg tccggaagta       600
     aaagaacaag tgaaatcaat gggagcggac ttccttgaaa tagatttcca agaagagggc       660
     ggtagcggtg acggttacgc aaaagtcatg tcagaagaat ttaatcgtcg agcgatggca       720
     ctttatgcgg aacaagcaaa agaagtggat attattatta ccacagcagc gattccgggt       780
     aaaccggcac cacgcttgat tactaaagaa atggtggatt ctatgaaacc gggtagtgtg       840
     attgtggatc ttgctgcact gacaggcgga aattgtgatt atacgcaagc cggtgaaatt       900
     gtggtaactg aaaatcaggt gaaagtcatc ggatatacag attttccaag tcgcttaccg       960
     acgcaatcct ctcaacttta cggcacaaac ttggttaatt tattaaaact tttatgcaaa      1020
     gaaaaagatg gcaatatcca tattgacttc gaagatgtgg tattgcgtgg tgtaaccgta      1080
     attcgtgatg gcgaggttac ttggccggct cctccgattc aagtgtctgc acaaactcaa      1140
     caaaaaataa ccgcacctgt tgtggataaa aaagaaaaaa cgccaataaa tcctaaagtg      1200
     aaatatgggg taatggcact ggcgggagcc gctttcctat ggctcggttc tgttatgccg      1260
     gctgcatttt tatcacactt tactgtattc gtattggctt gtgtggtcgg atattacgtt      1320
     gtatggaatg taagtcatgc attacataca ccattaatgg cagttactaa tgcgatttca      1380
     ggcattatca ttgtaggagc attattgcaa attgcacaag gaaatttctt tatcagtttg      1440
     ttggcgttca ttgctatttt ggttgcggca attaatattt ttggtggctt taaagtgact      1500
     caacgtatgc ttgccatgtt tagaaaaggt taa                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page