(data stored in ACNUC7421 zone)

EMBL: CP000947.PE101

CP000947.PE101       Location/Qualifiers
FT   CDS_pept        110621..112081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0101"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   hso:HS_0233 NAD(P)(+) transhydrogenase, beta subunit
FT                   (pyridine nucleotide transhydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30720"
FT                   /db_xref="GOA:B0UV59"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV59"
FT                   /protein_id="ACA30720.1"
FT                   /translation="MSEGLVQAAYIVAALLFIMSLAGLSKHETAKAGCWYGIVGMAIAL
FT                   VATIFGPYSQGLFWIIIAMAVGAVIGIQRAMKVEMTEMPELVAILHSFVGLAAVLVGFN
FT                   SFGLHETAQFLVPEGVEYVTDAAQALLAQQKADFVAEQSVLATIHNVEVFLGIFIGAVT
FT                   FTGSIVAFGKLRGIINSKALMLPHRHKLNLAALIISALLMVAFLNSPDNIFPVLLMTAI
FT                   ALAFGWHLVASIGGADMPVVVSMLNSYSGWAAAAAGFMLNNDLLIVTGALVGSSGAILS
FT                   YIMCKAMNRSFISVIAGGFGNDVVASSEAEQGEHRETTAEEVAEMLKNASSVIITPGYG
FT                   MAVAQAQYPVAEITAKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEI
FT                   NEDFADTDVVLVIGANDTVNPAAMDDPNSPIAGMPVLEVWKAANVVVFKRSMAVGYAGV
FT                   QNPLFFKENTQMLFGDAKERVEDILKAL"
     atgtctgaag gtttagtaca ggctgcctat attgttgcag cattactgtt cattatgagt        60
     ttagcaggtc tttctaaaca tgaaactgct aaagccggtt gttggtatgg cattgttggt       120
     atggcaattg cacttgttgc taccattttt ggaccatatt cacaaggatt attctggatt       180
     attattgcaa tggcagtcgg agccgtcatt ggtattcaac gtgcaatgaa ggttgaaatg       240
     actgaaatgc cggaattggt tgcaatttta catagttttg ttggtttggc ggctgtattg       300
     gtcggtttta atagtttcgg tttacatgaa accgcacaat ttttggtacc ggaaggtgtt       360
     gaatatgtca cggacgctgc tcaagcatta ttagcacaac aaaaagcgga ctttgttgcg       420
     gaacaatctg tattggcaac tattcacaat gttgaggtct ttttaggtat cttcattggt       480
     gcggtaacat ttaccggttc tattgtcgca ttcggtaaat tacgcggtat tattaattct       540
     aaagcgttaa tgttgcctca tcgccataaa ttgaatttgg cggcattgat tatttctgcg       600
     ttgttgatgg tcgcattttt gaattcacct gataatatct tccctgtatt actaatgaca       660
     gcgattgcac ttgcatttgg ttggcatctt gttgcttcaa taggcggtgc agatatgccg       720
     gttgtcgtat ccatgttgaa ctcttattca ggttgggcgg ctgcagcggc aggcttcatg       780
     ttaaataatg atttgctcat cgttaccggt gcattagtag gttcatcagg ggcaattttg       840
     tcatacatta tgtgtaaagc aatgaaccgc tcttttatca gtgtcattgc cggtggattc       900
     ggtaatgatg tagttgcttc atcagaggca gaacaaggtg aacatcgtga aacaacagcc       960
     gaagaagtgg cggaaatgtt gaaaaatgca agctctgtta ttattacacc gggatatggt      1020
     atggcagtgg ctcaagcaca atatccggtt gcggaaatta cagcaaaatt gcgtgaacgt      1080
     ggtgtgaatg ttcgctttgg tattcaccct gtagccggaa gattgccagg gcatatgaac      1140
     gtattgcttg cagaagcgaa agtgccttat gatgttgtac ttgaaatgga tgaaatcaat      1200
     gaagattttg cggataccga tgtcgtatta gtcattggtg caaatgatac agtgaaccct      1260
     gccgccatgg atgatccgaa tagtccaatt gcaggcatgc cagttctaga agtttggaaa      1320
     gcggctaatg ttgtcgtatt caaacgctct atggcggtag gatatgctgg tgtacaaaat      1380
     ccgttgttct ttaaagaaaa tacccaaatg ctttttggtg atgcaaaaga gcgagtagaa      1440
     gatattttga aagcgttata a                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page