(data stored in ACNUC7421 zone)

EMBL: CP000947.PE103

CP000947.PE103       Location/Qualifiers
FT   CDS_pept        complement(114180..115190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0103"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pmu:PM1040
FT                   galactoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30742"
FT                   /db_xref="GOA:B0UV61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR030158"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV61"
FT                   /protein_id="ACA30742.1"
FT                   /translation="MSALKQNKSLDFLKQNAIYFVLLILLGIIIMQDSSFLSLRNFSNI
FT                   LTQSSVRLIIALGVAGLLVTQGTDLSAGRQVGLAAVISATLLQAMDNINRVFPELGEIP
FT                   IPVVIIVVCVIGAIIGLVNGVVIAFLNVTPFIATMGTMIIVYGINSLYYDAVGSSPIAG
FT                   FNESFSTFAQGFFRIGSFKLSYITIYAALASFFVWVLWNKTRFGKNIFAIGGNPEAAKV
FT                   SGVNVTRNLVVIYMIAGIFYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFAG
FT                   GVGTVLGVVTGVLIFTVINYGLTYIGVNPYWQYIIKGSIIIFAVAIDSLKYAKKK"
     atgtctgctt taaaacaaaa caaatcgcta gatttcctta aacaaaacgc aatttatttt        60
     gtgttattga tcttactcgg aattattatt atgcaagact caagtttctt aagtttaaga       120
     aactttagta atattttaac gcaatcctcc gttcgcttaa ttattgcctt aggcgttgca       180
     ggtttattag ttacacaagg aacagacttg tcagcgggtc gtcaagtcgg tctagctgca       240
     gttatttcgg caactctgtt acaggcaatg gataatataa atagagtttt ccctgaactt       300
     ggtgaaattc ctattcctgt tgtaatcata gtagtttgtg tgattggggc aataattgga       360
     ttggtaaatg gggttgtgat tgcgttctta aatgtcacac ctttcattgc cacgatggga       420
     acgatgatta tcgtttacgg tattaactct ctctattatg atgctgtcgg ttcttcacct       480
     attgcagggt tcaacgaaag tttctctaca tttgctcaag gctttttccg tataggttct       540
     ttcaagcttt cctatattac aatctatgca gctttggctt ctttctttgt atgggtacta       600
     tggaataaaa cacgtttcgg taaaaacatt ttcgctatcg gtggtaatcc ggaagcagca       660
     aaagtatcgg gtgttaacgt tactcgtaac cttgtcgtca tttacatgat tgcaggtata       720
     ttctacgctt tcggggggat gttagaagcg ggacgtatcg gttctgccac caacaatcta       780
     ggttttatgt atgaacttga tgccattgca gcttgcgttg taggcggtgt atcttttgca       840
     ggcggtgttg gtactgtact aggcgtagta accggtgtat taatttttac tgtcatcaac       900
     tatggtttaa cctatattgg tgtaaatcca tattggcaat atattatcaa aggttcaatt       960
     attatctttg ccgttgcaat tgattccttg aaatatgcga agaaaaaata g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page