(data stored in ACNUC7421 zone)

EMBL: CP000947.PE105

CP000947.PE105       Location/Qualifiers
FT   CDS_pept        complement(116780..117766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0105"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: pmu:PM1038 d-galactose
FT                   binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30764"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV63"
FT                   /protein_id="ACA30764.1"
FT                   /translation="MKKTILSAVTLAVGFSAISAQSADRIGVTIYKYDDNFMALMRQEI
FT                   DKEAKAVGGLELLMNDSQNAQSVQNDQVDVLISKGIKTLAINLVDPAAAPTVIKKAKSE
FT                   DIPVIFFNKDPGAKAIGSYNHAYYVGTDPKESGLIQGNLIAKHWKANPAYDLNKDGKIQ
FT                   YVLLKGEPGHPDAEARTKYVIEALNAQGIQSEQLFIDTGMWDAAMAKDKVDAWLSSSKA
FT                   NEIEVIISNNDGMAMGALEATKAHGKKLPIFGVDALPEVLQLIKKGEMAGTVLNDGVNQ
FT                   GKAVVQLAKNLAQGKPATEGTNWKLEKRVVRIPYVGIDKDNLNEFLK"
     atgaaaaaaa caatattaag tgcggtaact ttagctgtag gttttagtgc aatctcagca        60
     caatcagctg atcgtatcgg tgtaaccatt tacaaatacg acgataattt tatggcgtta       120
     atgcgtcaag aaatcgataa agaagcaaaa gctgtaggtg gattagagtt gttaatgaat       180
     gattcacaaa atgcacaatc tgttcaaaat gatcaggttg atgtattaat ttccaagggc       240
     attaaaacat tagcaataaa ccttgttgac cctgccgctg caccaactgt cattaaaaaa       300
     gcaaaatcgg aggatattcc agttatcttc ttcaataaag atcccggagc aaaagcaatt       360
     ggaagctata accacgctta ctatgtcggt acggatccta aagaatccgg actcattcaa       420
     ggtaatttaa ttgcgaaaca ttggaaagca aatccagcct atgacttaaa taaagatggg       480
     aaaattcaat atgtcttatt gaaaggtgaa ccggggcatc cggatgctga agctcgtacc       540
     aaatacgtaa ttgaagcact caatgctcag ggtattcaat cagaacaatt gttcattgat       600
     actggtatgt gggatgctgc aatggcaaaa gataaagtgg atgcttggtt atccagctct       660
     aaagcaaacg aaattgaggt tattatttct aataatgacg gtatggcaat gggtgcattg       720
     gaagcaacta aagcccatgg taaaaaactc ccgattttcg gtgtcgatgc cttgccggaa       780
     gtattacagt taattaagaa aggtgaaatg gcaggtaccg tactaaatga tggtgttaac       840
     caaggtaaag cagtggttca acttgcaaaa aatttagcac aaggtaaacc tgcaacagaa       900
     ggaacaaact ggaaattaga aaaacgtgtt gttcgtattc cttatgtcgg cattgataaa       960
     gacaacttaa atgaattctt aaaataa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page