(data stored in ACNUC7421 zone)

EMBL: CP000947.PE106

CP000947.PE106       Location/Qualifiers
FT   CDS_pept        119165..120214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0108"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   PFAM: galactose-1-phosphate uridyl transferase domain
FT                   protein; KEGG: pmu:PM1036 galactose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30795"
FT                   /db_xref="GOA:B0UVG9"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR019779"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVG9"
FT                   /protein_id="ACA30795.1"
FT                   /translation="MSEMTEFVATEHPHRRYNPLTEQWVLVSPHRAKRPWQGQQEKIAD
FT                   ENKPCYDSACYLCPGNKRITGEQNPNYTKPFVFKNDFSALLEDTPEPLKTDDPLFQSSL
FT                   ARGESRVVCFSPDHSKTLPLLTVEEIFAVVKVWQEQLEELGKKYQWVQIFENKGAVMGC
FT                   SNPHPHGQIWANSFLPNEVARTDKAQRNYFNKQGSVLLMDYQKRERDLQERVVIETEYW
FT                   VAVVPYWAVWPFEILLLPKIHVKRLIDLNETQAKDLALALKIITTKYDNLFETSFPYSM
FT                   GFHFAPFNGEKNEHWQLHAHFYPPLLRSATVRKFMVGYEMLGESQRDLTAEQAAARLRE
FT                   LSDVHYKNK"
     gtgagtgaaa tgaccgaatt tgttgcgaca gaacatccgc atcgtcgtta taatcctttg        60
     acggaacaat gggttttagt ctctccgcat cgagctaagc gaccttggca gggacaacag       120
     gaaaaaatag ctgatgaaaa taaaccttgt tacgattccg cttgttatct ttgtccgggg       180
     aataagcgta ttaccggtga gcaaaatccg aattatacga aaccttttgt gtttaaaaat       240
     gatttttccg ctttattgga agatacgcct gaaccactaa aaacggatga ccctttattt       300
     caatccagtc tagcacgtgg cgaaagcagg gtagtttgtt tttctccgga tcatagtaag       360
     acgttgccgt tattaacggt agaggaaatt tttgcagtgg taaaagtttg gcaagaacag       420
     ctggaggagc ttggtaaaaa atatcaatgg gtacaaattt ttgagaataa aggtgcggtt       480
     atgggctgct ctaatccgca tccacatgga caaatttggg caaatagttt tttgcctaat       540
     gaagttgctc ggacagacaa ggcacaacga aattacttca ataaacaagg ttcggttttg       600
     ttaatggatt accaaaaacg tgaacgagat ttgcaggaaa gagtagtaat tgaaacggaa       660
     tattgggttg cagttgtgcc ttattgggcg gtttggccat ttgaaatatt gttactaccc       720
     aaaattcacg tgaagcgatt aattgatctg aatgagacgc aggcaaagga tcttgccttg       780
     gcattaaaaa taatcacaac caaatatgat aatttgtttg aaacttcttt tccttattct       840
     atggggttcc attttgcacc ttttaatggt gaaaagaatg aacattggca acttcatgca       900
     catttttatc caccgctact ccgttcggca acggtgcgta aatttatggt cggttatgaa       960
     atgttagggg aaagtcagcg agatttaacc gctgaacagg ctgcagcaag gttgcgtgaa      1020
     ttaagcgatg ttcattataa aaataaataa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page