(data stored in ACNUC7421 zone)

EMBL: CP000947.PE107

CP000947.PE107       Location/Qualifiers
FT   CDS_pept        120233..121399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0109"
FT                   /product="galactokinase"
FT                   /note="TIGRFAM: galactokinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: msu:MS0648 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30806"
FT                   /db_xref="GOA:B0UVH0"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH0"
FT                   /protein_id="ACA30806.1"
FT                   /translation="MTQQNPKQRAKQLFSEKFNRTSELNVYAPGRVNIIGEHTDYNDGF
FT                   VMPCAINYGTAISGAKRDDHLFCVYAADLQEYDEFDLTRPIEPKMEAKWTGYVRGMVKF
FT                   IQQHCPDFQQGADLVICGNIPLSAGLSSSASLEIAVGKFCQQLADLSLTNIEIALIGQQ
FT                   AENKFVGANCGNMDQLISALGQKDHFLMIDCRSLDIVTIPVPENIVVMIVNSHVKHDLV
FT                   NGEYNIRRRQCEMAAQFFGVKALRDVSVELFKQKEAELTALDPEIAKRAKHVVTENERV
FT                   LQSVQALQQGDLQKLGELMYQSHDSMRDDFEITVPEIDYLVELAQVVIGKNGGARMTGG
FT                   GFGGCIVAIAPQDKVEAVRQIIADNYEKQTGLKEDFYVCTASKGVTIC"
     atgactcaac aaaatccaaa acagcgagcg aaacaattat ttagtgaaaa atttaaccgc        60
     acttctgaac tgaatgtcta tgcccccgga cgagtaaata ttattggtga acacacggat       120
     tataatgatg gatttgtgat gccttgtgca attaattatg gaacggcgat cagcggagca       180
     aaacgagatg atcatttatt ttgtgtatat gcggcagatt tacaagaata tgatgaattt       240
     gatttaactc gacctattga acccaaaatg gaagctaaat ggacaggtta tgttcgaggt       300
     atggtgaaat ttattcaaca acattgccct gattttcaac aaggtgcgga tctggttatt       360
     tgtggaaata tcccactttc agccggatta agttcttctg catctttaga aattgctgta       420
     ggtaaatttt gtcagcaact agcggactta tctttaacaa atatagaaat tgcattaata       480
     ggtcagcagg cagagaataa atttgtaggt gcaaattgtg gaaatatgga tcaattaatt       540
     tccgcattgg gtcaaaaaga tcattttctc atgattgact gtcgatcttt agatattgtt       600
     accatacctg ttcctgaaaa tattgttgtg atgattgtga attctcatgt gaaacatgat       660
     ttagtaaatg gcgaatataa tatacgccgt cgacaatgtg aaatggcagc ccaatttttt       720
     ggcgtgaaag ccttacgtga tgtatctgtg gagttgttca aacaaaagga agcagaatta       780
     accgctcttg atcctgaaat agcgaaacgt gccaaacatg ttgtgacgga aaatgagcgg       840
     gttttacaat cagttcaggc cttacaacag ggagatttgc aaaaattagg ggaattaatg       900
     tatcaatctc atgattccat gcgtgatgat tttgaaatta ctgtgcctga aattgattat       960
     ttagtggagt tggcacaggt cgttatcggc aaaaatggtg gagcacgcat gaccggcgga      1020
     ggttttggcg gttgtatcgt cgctattgca ccgcaagaca aagtggaggc agtacgtcaa      1080
     attattgcag acaactatga aaaacaaaca ggtttgaaag aagattttta tgtttgtacc      1140
     gcttctaaag gagtgacgat atgctaa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page