(data stored in ACNUC7421 zone)

EMBL: CP000947.PE109

CP000947.PE109       Location/Qualifiers
FT   CDS_pept        122612..123505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0111"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: hso:HS_0237 magnesium
FT                   and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30829"
FT                   /db_xref="GOA:B0UVH2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH2"
FT                   /protein_id="ACA30829.1"
FT                   /translation="MSNDEQINTITENESKKNFFHSLFGRFFQGELKNRQELVDVIRDS
FT                   EQNELIDQNTREMIEGVIEISELRVRDIMIPRSQIIFIENDQDLEACLDVIIASAHSRF
FT                   PVISDERDNIAGILHAKDLLKFFRSNAEQFELQSLLRPAVIVPESKRVDRMLKDFRAER
FT                   FHMALVVDEFGAISGLVTIEDILEQIVGDIEDEFDEEDVADIRQLSRHTYVVRALTDID
FT                   DFNEQFKTNFADEEVDTIGGLIMQAFGYLPKRGEEVVLDNLNFKVTSADSRRIIQVRVT
FT                   VPDEQLTDSKKQNTEE"
     atgagtaacg acgaacagat taatacaatc acagaaaatg aaagtaagaa aaatttcttt        60
     cactctttat ttggacgctt ttttcagggt gaattgaaaa atcgtcaaga attagtagac       120
     gttatccgag attctgaaca aaatgagctc attgatcaaa atacacgtga aatgattgaa       180
     ggtgttatcg aaatctcaga attaagagtt cgagatatta tgatcccacg ttcacagatt       240
     atttttatcg aaaatgatca ggatcttgaa gcgtgtcttg atgttattat tgcaagtgca       300
     cattctcgtt tcccggttat cagtgatgag agagataata ttgccggtat tttacatgca       360
     aaagatttac ttaaattttt tcggtctaat gcggagcaat tcgaattaca aagtttatta       420
     cgacctgccg ttattgtacc ggaaagtaag cgtgtggatc gaatgttaaa agattttcgt       480
     gctgaacgtt ttcatatggc actagttgtt gatgaattcg gtgcgatttc aggtttagtt       540
     accatagaag atattttgga acaaatagtg ggggatattg aagatgaatt tgatgaggaa       600
     gatgtggcgg atattcgtca gttgtctcgt catacttatg tagtacgagc tttgacggat       660
     attgatgatt ttaatgagca atttaagacc aattttgccg atgaagaagt ggatactatc       720
     ggaggtttga ttatgcaagc attcggctat ttaccgaaac gtggtgaaga agttgtactg       780
     gataatttga attttaaagt tacttcggca gatagtcgtc gtattattca agtacgagtt       840
     actgtgccgg atgagcaact tacagacagt aaaaaacaga atacagaaga atga             894
//

If you have problems or comments...

PBIL Back to PBIL home page