(data stored in ACNUC7421 zone)

EMBL: CP000947.PE114

CP000947.PE114       Location/Qualifiers
FT   CDS_pept        complement(128105..128848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0116"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   hso:HS_0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30884"
FT                   /db_xref="GOA:B0UVH7"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVH7"
FT                   /protein_id="ACA30884.1"
FT                   /translation="MKIDMHRTKLEQKQPHFDAQKRRKKECKNSNTPFVRPKLELPHGH
FT                   NKLLLHSCCAPCSGEVMEAIHASGIDFTIYFYNPNIHPLKEYLIRKEENIRFAEKWGIP
FT                   FIDADYDRQNWFDRAKGMEDEPERGIRCTMCFDMRFEKAAQYAHENGFPVFTSCLGISR
FT                   WKDMNQINGCGHRAAEKYDDVVYWDYNWRKGGGSQRMIEISKRERFYQQEYCGCVYSLR
FT                   DTNKWREANGRQKIEIGKLYYSADK"
     atgaaaatag atatgcacag aaccaaactt gaacaaaagc aaccgcactt tgatgcacaa        60
     aagcgtcgta agaaagaatg taaaaattcg aatacacctt tcgtacgtcc caaattagaa       120
     ttaccacatg gacataataa actgttatta cattcttgtt gtgcaccttg ctccggagaa       180
     gtcatggaag ctattcatgc ttcaggcatt gattttacaa tttactttta taatcccaat       240
     attcatccgt taaaagaata tttaattcgt aaagaagaaa atattcgctt cgccgagaaa       300
     tggggaattc ctttcattga tgcagattat gatcgtcaaa attggtttga tcgtgcaaaa       360
     ggaatggaag atgaaccgga acggggcatt cgttgtacaa tgtgctttga tatgcgtttt       420
     gaaaaagccg cacagtatgc ccatgaaaat ggtttccctg tttttactag ttgcttagga       480
     atttctcgtt ggaaagatat gaaccaaatt aatggttgtg gacatcgtgc agcggaaaaa       540
     tatgatgatg tggtttattg ggattacaat tggcgtaaag gcggagggtc gcaacgaatg       600
     attgaaatca gtaaacgaga acgtttttac caacaagaat actgcggttg cgtctattct       660
     ttacgagata caaacaaatg gcgtgaagca aatggtcgtc agaaaattga gattggtaaa       720
     ttatattatt ctgctgataa gtaa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page