(data stored in ACNUC7421 zone)

EMBL: CP000947.PE116

CP000947.PE116       Location/Qualifiers
FT   CDS_pept        130182..130493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0118"
FT                   /product="ribosomal protein L21"
FT                   /note="PFAM: ribosomal protein L21; KEGG: hso:HS_0245 50S
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30903"
FT                   /db_xref="GOA:B0UVH9"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVH9"
FT                   /protein_id="ACA30903.1"
FT                   /translation="MYAVFQSGGKQHRVSEGHVVRLEKLELATGSTVEFDSVLMIVNGE
FT                   DIKIGTPVVTGAKVVAEVVSQGRGEKVKIVKFRRRKHSRKQQGHRQWFTEVKITGIQA"
     atgtacgcag tttttcaaag tggcggtaaa cagcaccgtg taagcgaagg tcatgttgtt        60
     cgtttagaaa aacttgaatt ggcaacgggc tctactgttg agttcgattc agtattgatg       120
     atcgttaacg gcgaagatat taagatcggt acaccagtag tgacaggtgc taaggtagtg       180
     gctgaagttg tgtcgcaggg acgtggcgaa aaagttaaaa tcgttaaatt ccgtcgtcgt       240
     aaacacagtc gtaaacaaca aggtcatcgt cagtggttca cagaagtgaa aatcactggg       300
     attcaagcat aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page