(data stored in ACNUC7421 zone)

EMBL: CP000947.PE117

CP000947.PE117       Location/Qualifiers
FT   CDS_pept        130514..130771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0119"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: hso:HS_0246 50S
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30913"
FT                   /db_xref="GOA:B0UVI0"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVI0"
FT                   /protein_id="ACA30913.1"
FT                   /translation="MATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGSNVGMGKDHTLFATADGKVKFEVKGEKSRKYVSVVAE"
     atggcaacta aaaaagctgg tggttcaact cgtaacggtc gtgattctga agctaaacgt        60
     cttggtgtga aacgtttcgg tggcgaatca gtattagcag gtagtattat tgttcgtcag       120
     cgtggtacta aattccatgc gggttcaaat gtaggtatgg gtaaagatca tactttgttc       180
     gctactgctg atggtaaagt aaaatttgaa gttaaaggcg agaaaagtcg taaatacgtt       240
     tctgttgtag ccgaataa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page