(data stored in ACNUC7421 zone)

EMBL: CP000947.PE118

CP000947.PE118       Location/Qualifiers
FT   CDS_pept        130907..131827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0120"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: hso:HS_0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30923"
FT                   /db_xref="GOA:B0UVI1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI1"
FT                   /protein_id="ACA30923.1"
FT                   /translation="MKQKPLLGFIFALTTAIAWGSLPIALQQVMNAMSMQTIVWFRFMV
FT                   ATVALAILLKLANRLPKLSDLNRYFFGLVILGVIGLSGNFSLFNSSLKFIEPSVTQIFV
FT                   HFSSFAMMFCGVVIFKERLGLHQKIGLVILIIGLILFFNERADQLFDINIYSIGVFLSM
FT                   SASLIWVTYGLAQKLLLRRFNSQQILLMIYTGCAFVFTPFVEIEQLQNLNTFTLICFIY
FT                   CCLNTLIGYGAYAEALNHWDVAKVSVVITLVPLFTILFAHLLNLIYPQYFSAPELNTLS
FT                   YIGAFIVVFGAMTSAIGYKFIKNKI"
     atgaaacaga aaccattact cgggtttata tttgcattga ctactgcgat agcttgggga        60
     tctttaccta ttgcattaca acaagttatg aatgctatga gtatgcaaac tatcgtttgg       120
     ttcaggttta tggttgctac tgttgcatta gctattttac ttaaattagc gaacagatta       180
     cctaaattat cagatctcaa tcgttacttt tttggactgg ttatattagg tgttataggg       240
     ctatctggaa actttagtct gtttaattcc tcattaaaat ttattgagcc ttctgttact       300
     caaatttttg tgcatttttc ttcctttgca atgatgttct gtggagttgt gatctttaaa       360
     gaaaggttag gattacatca aaaaattggt ttagttattc taattattgg acttatctta       420
     tttttcaatg agcgagcgga ccaattattt gatattaata tctattctat aggcgtattt       480
     ttaagtatgt cggcatcctt gatttgggta acttacggac ttgcacaaaa attactttta       540
     cgccgtttta actctcaaca gattttattg atgatttata cagggtgtgc atttgttttt       600
     actccttttg ttgagattga gcaattgcaa aatctaaata cttttacgct aatttgtttt       660
     atttattgtt gtctgaatac actaataggt tatggtgcct atgctgaggc attaaaccat       720
     tgggatgttg ccaaagtaag tgttgtcatt accttggtac ctttgttcac tattttattt       780
     gctcacttat taaatttaat atacccacag tatttttcag cccctgaatt aaatacgctc       840
     agctatattg gtgcgttcat tgttgtcttt ggtgcaatga cctcagctat tggttataaa       900
     tttatcaaga ataaaattta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page