(data stored in ACNUC7421 zone)

EMBL: CP000947.PE119

CP000947.PE119       Location/Qualifiers
FT   CDS_pept        131837..133015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0121"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Obg/CgtA; PFAM: GTP-binding protein HSR1-related;
FT                   GTP1/OBG sub domain protein; KEGG: hso:HS_0248 GTP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30934"
FT                   /db_xref="GOA:B0UVI2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVI2"
FT                   /protein_id="ACA30934.1"
FT                   /translation="MKFIDEALIRIEAGDGGNGCVSFRREKFIPKGGPDGGDGGDGGDV
FT                   YLIADENLNTLIDYRFEKSFAAERGENGRSSDCTGRRGKDITLRVPVGTRAIDNDTKEV
FT                   LGDLTKHGTKMLVAKGGYHGLGNARFKSSVNRAPRQKTNGTPGEKRDLQLELMLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVTRVDTSRSFVIADIPGLIEGAS
FT                   EGAGLGVRFLKHLERCHVLIHLVDIAPIDESDPADNIAIIEGELFQYSEKLANKPRWLV
FT                   FNKIDILSDEEATARAKNIMQRLGGEDDYYLISAATGKNVDVLCRDIMDFIEENPRQEQ
FT                   EKIDAQEVKFKWDDYHQEQLSEQVFTEDDQEEDDWDDWSEDDEEGVEIIYKP"
     atgaaattta ttgatgaggc actgattcgt atcgaagctg gtgatggcgg taacggctgt        60
     gtaagttttc ggcgagagaa atttattccg aaaggtggtc ctgatggcgg tgatggcggt       120
     gatggcggtg atgtatatct aattgccgac gagaatttaa atacattgat tgattaccga       180
     tttgaaaaaa gctttgcagc agagcgtgga gagaatgggc gtagttctga ttgtacagga       240
     cgtagaggca aagacattac attaagggta ccagtcggaa caagagcaat tgataacgat       300
     accaaagaag tgttgggtga tttaactaaa catggtacca aaatgttagt tgcaaaaggt       360
     ggttatcatg gactggggaa tgcacgtttc aaatcttcag tgaacagagc accaagacag       420
     aaaaccaatg gaacaccggg tgaaaagcga gatttgcaat tggaattaat gcttttagcc       480
     gatgttggta tgttgggatt acccaatgca ggaaaatcaa catttattcg agctgtttcc       540
     gcagctaaac cgaaagttgc agattatcct tttactacat tagttcctag tttaggcgtt       600
     actcgtgttg atactagccg tagctttgtg attgcagata ttcccggatt aattgagggg       660
     gcttctgaag gtgctgggtt gggagtacga tttttaaaac atttggagcg ttgtcatgtc       720
     ttaattcatt tggttgatat tgcaccaatt gatgagagtg atccagcgga taatattgca       780
     atcattgaag gtgaattatt tcaatatagt gaaaaattag cgaataaacc tcgttggtta       840
     gttttcaata aaattgatat actttcagat gaagaagcaa ccgcacgtgc aaagaatatt       900
     atgcaacgtt tgggtgggga agatgattat tatttgattt cagccgcaac aggtaaaaat       960
     gtagacgttt tatgccgcga tattatggat tttattgaag aaaatccacg tcaagaacaa      1020
     gaaaagatag atgctcaaga agtgaaattt aaatgggatg actatcatca agaacaattg      1080
     tccgaacagg tctttacaga agatgaccaa gaagaggatg attgggacga ttggtcggaa      1140
     gacgatgagg aaggtgtaga aattatttat aaaccttag                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page