(data stored in ACNUC7421 zone)

EMBL: CP000947.PE12

CP000947.PE12        Location/Qualifiers
FT   CDS_pept        8734..9546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0012"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycolase; zinc finger Fpg domain
FT                   protein; KEGG: hso:HS_0146 DNA-formamidopyrimidine
FT                   glycosylase (formamidopyrimidine-DNA glycosylase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30922"
FT                   /db_xref="GOA:B0UUX0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUX0"
FT                   /protein_id="ACA30922.1"
FT                   /translation="MPELPEVETTLKGVSPYLKGFIIEKIVVRNPKLRWEVSKELSTFK
FT                   HVKILNLTRRAKYLIIHTEQGYIIGHLGMSGSVRIVPHDNPVNKHDHFDIVMNNGKLLR
FT                   YNDARRFGAWLWTNNLSEFHLFFKLGPEPLSETFNSTYLFKKSRQKSTALKTFLMDNSV
FT                   VVGVGNIYANEILFLCGLHPQKIAKTLTKKQTEQLVFTIKQVLNEAIEQGGTTLKDFLQ
FT                   PDGRPGYFAQKLLVYGNKDKPCPRCGTKIKSIIIGQRNSFFCPQCQKK"
     atgcctgaat tacctgaagt tgaaacaacc ttaaagggcg taagccctta tttaaaaggg        60
     tttataattg aaaaaatagt agtacgtaat cccaaattac gctgggaagt aagtaaagaa       120
     ctcagcacat ttaaacacgt taaaattctt aacttaactc gtcgagccaa gtatctcatt       180
     atccacacgg aacaaggtta cattatcgga catttaggta tgtccggttc agtccgcatt       240
     gtgccgcatg acaatcctgt caataagcat gatcatttcg atattgttat gaacaacggc       300
     aaattactac gctataacga tgctcgtcgc tttggtgctt ggctatggac gaataacctt       360
     agtgaatttc atcttttttt caagttgggg ccggaacctt tatctgaaac gtttaattct       420
     acttatttgt tcaaaaaatc tcgtcaaaaa agcaccgcac ttaaaacttt cttgatggat       480
     aattccgttg ttgtaggggt tggaaatatt tatgcgaatg aaattttatt tctatgtgga       540
     cttcatccac aaaagatcgc caaaacattg acaaaaaaac agactgaaca acttgttttc       600
     actattaaac aagtgcttaa cgaagctatt gaacaaggag gaacaaccct aaaagatttt       660
     ttacaacctg acggtcgccc cggatatttt gctcaaaaac ttttggttta tggaaataag       720
     gacaagcctt gtccaaggtg cggtacaaag ataaaaagta ttattattgg gcaaagaaat       780
     agcttttttt gtccgcaatg tcaaaaaaag tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page