(data stored in ACNUC7421 zone)

EMBL: CP000947.PE121

CP000947.PE121       Location/Qualifiers
FT   CDS_pept        133949..134407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0123"
FT                   /product="fimbrial subunit"
FT                   /note="KEGG: hso:HS_0250 fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30956"
FT                   /db_xref="GOA:B0UVI4"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI4"
FT                   /protein_id="ACA30956.1"
FT                   /translation="MKITYIFSSVKKGFTLIELMIVIAIVAILATIAIPSYQNYTKKAA
FT                   ITELLQASAPYRAEVELCVYNNDAPTNCNAGTNGIQAAINTPKGKVKSVSVQGGAITVT
FT                   GNGNLKDITYTLTPTGDASTGVTWSANCNNKADLFPAGFCSSTSTNSP"
     atgaaaataa cctatatttt ttcatcagtt aaaaaaggat ttactctcat agaactgatg        60
     attgttattg ctattgtggc aattcttgca accattgcaa ttccgtcata ccaaaattat       120
     acaaaaaaag ctgcaattac agagctattg caagcttcag ctccttatcg tgcagaagtt       180
     gagctatgcg tgtataacaa tgatgcaccg acaaattgta atgctggaac aaatggaatt       240
     caagcggcaa tcaatacacc aaaaggtaaa gtaaaatcag ttagcgtgca aggtggagcc       300
     attactgtta cagggaatgg aaatcttaaa gatattactt ataccttaac accaacaggc       360
     gatgcttcaa ccggcgttac ttggagtgca aattgcaata ataaggcgga tctatttcct       420
     gccggatttt gctcttctac gtctacaaac tctccttaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page