(data stored in ACNUC7421 zone)

EMBL: CP000947.PE122

CP000947.PE122       Location/Qualifiers
FT   CDS_pept        134553..135290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0124"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0251 arginine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30967"
FT                   /db_xref="GOA:B0UVI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI5"
FT                   /protein_id="ACA30967.1"
FT                   /translation="MTISVKNLNFFYGASQALFDINLTAEDGDTVVLLGPSGAGKSTLI
FT                   RTLNLLEVPTSGELSIANNKFDLSQDIANPKQMRQLRQDVGMVFQQYNLWPHLTVMENL
FT                   IEAPIKVLGIAKEKAKEQAIELLKRLRLEEFAERFPLHLSGGQQQRVAIARALMMKPQV
FT                   LLFDEPTAALDPEITAQIVSIIQELQEMGITQVIVTHEVAVAKKVATKVVYMEQGRIVE
FT                   MGDSSCFEQPSTEQFKQYLSHSH"
     atgacaatta gtgttaaaaa tttaaatttt ttttatggtg catcacaggc actgtttgat        60
     attaatctca cagctgaaga tggtgatacc gttgttttat tgggaccaag tggtgcaggg       120
     aaaagcacct tgattagaac gttaaaccta cttgaagttc caacatctgg agaattgagt       180
     attgccaata ataaattcga tctctcgcaa gatattgcca acccaaagca aatgcgtcaa       240
     ttgcgtcaag atgtaggtat ggtatttcaa caatacaatt tatggcctca tttgactgta       300
     atggaaaatc ttattgaggc accgattaaa gttttaggga tagcgaaaga aaaagccaaa       360
     gaacaagcta ttgaattatt aaaacgatta cgcttggaag aattcgctga aaggtttcca       420
     ctgcacttat caggaggaca gcaacagcgt gttgctattg ctcgtgcatt aatgatgaag       480
     ccgcaagttt tattatttga tgaaccgaca gcggcattag atcctgaaat tacagctcag       540
     attgtatcaa tcattcaaga gttacaggaa atgggcatta cacaagttat tgtaacgcat       600
     gaagttgcgg tggcaaaaaa ggttgcaacc aaagttgtct atatggaaca aggtcgcatc       660
     gttgaaatgg gggattccag ctgttttgaa caaccctcaa cagagcaatt taaacaatat       720
     ttatctcact cacactaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page