(data stored in ACNUC7421 zone)

EMBL: CP000947.PE123

CP000947.PE123       Location/Qualifiers
FT   CDS_pept        135308..136033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0125"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: hso:HS_0252 arginine ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30978"
FT                   /db_xref="GOA:B0UVI6"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI6"
FT                   /protein_id="ACA30978.1"
FT                   /translation="MKKLLLATMLAGATIGANAQDITFAMEPSYPPFELTNEKGEIIGF
FT                   DVDIANAICKEIQANCSFKAQAFDALIPSLIKGRGGFDAAISAIDITEARAKQVAFTDS
FT                   YYESSASFIALKGKADLTTAKVVGVQNGTTYQQYANKEAKQYQSKSYASLQDAILDLKN
FT                   GRIDLIFGDTDVLRDMFDKNPELQFVGERVTDKRYFNNGLGIAVNKKNTALVEQLNKGI
FT                   SAIKANGEYQKIYDKWMTK"
     atgaaaaaat tacttttagc aacaatgttg gctggtgcta cgattggtgc aaatgcacaa        60
     gatattactt ttgctatgga accaagttat ccaccatttg aattaactaa tgaaaaaggt       120
     gaaattattg gttttgacgt tgatattgct aatgcgattt gtaaagaaat tcaagctaat       180
     tgtagcttca aagcccaagc gtttgatgcg ttaattccaa gtttaattaa aggtcgcggt       240
     gggtttgatg cggcaatttc agcgattgat attacggaag ctcgtgcaaa acaagtagca       300
     tttaccgatt cttattatga aagttctgcc agttttattg cattaaaagg gaaagcggat       360
     ttaacgacgg caaaagtggt tggtgtacaa aacggtacaa cgtatcagca atatgcgaat       420
     aaagaagcga agcaatatca atctaaatct tatgctagct tacaagatgc aattttggat       480
     ttaaaaaatg gtcgtattga tctcattttt ggtgatacgg atgtattaag agatatgttt       540
     gataaaaatc cggaattgca gtttgtgggc gagcgtgtaa cggataaacg ttatttcaat       600
     aacggcttgg gaattgcggt aaataaaaag aataccgcac ttgttgagca attaaataaa       660
     ggtatttcgg caatcaaagc aaacggcgaa tatcaaaaaa tttatgataa atggatgact       720
     aaataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page