(data stored in ACNUC7421 zone)

EMBL: CP000947.PE124

CP000947.PE124       Location/Qualifiers
FT   CDS_pept        136038..136709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0126"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: hso:HS_0253
FT                   arginine ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30989"
FT                   /db_xref="GOA:B0UVI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI7"
FT                   /protein_id="ACA30989.1"
FT                   /translation="MFIDYLPLMYTATLMTLGLAVCSLLLGLALSIFFVVLETHKWACI
FT                   RKPTATIVTLLRGLPEILVVFLIYFGVPEILEWVIGEYVEFGAFGCGVVALSIIFASYA
FT                   SQSLRGAIQAIPLGQWESGAALGLSRSYTFIFLIMPQVWRHALPGLSNQWLVLLKDTAL
FT                   VSLIGVHDLMRQAELINTNTHQPFTWYGFAALLYLLITLFSQFIIRKLERRVTRFERAT
FT                   N"
     atgtttattg attatttacc tttaatgtat accgcaaccc tgatgacctt agggttggcg        60
     gtttgttctt tattactcgg attggcatta tctattttct ttgtagtatt agaaacacac       120
     aaatgggcat gtattcgtaa accgacagcc actattgtga cattattacg agggttacct       180
     gaaattcttg tggtttttct aatttatttt ggcgtacctg aaatactgga atgggtaatc       240
     ggagaatatg tagagtttgg tgcctttggt tgtggcgtgg ttgcactgtc tattattttt       300
     gcttcttatg cttctcaatc tttgcgtgga gcaattcagg ctataccttt aggacagtgg       360
     gaatccggtg cagcattagg tttgagtcgt agttatacgt ttatttttct tattatgccg       420
     caagtttggc gacacgcttt accgggattg agtaatcaat ggttagtgtt attaaaagat       480
     accgcacttg tgtcgttaat cggtgtgcat gacttaatgc gtcaagctga attaatcaac       540
     accaatactc accaaccttt tacttggtat ggatttgcag cattgcttta tttgttgatt       600
     acgctattta gtcaatttat tattcgtaaa cttgagcggc gagtcacacg ctttgaacgt       660
     gctacaaatt aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page