(data stored in ACNUC7421 zone)

EMBL: CP000947.PE125

CP000947.PE125       Location/Qualifiers
FT   CDS_pept        136720..137403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0127"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: hso:HS_0254 arginine ABC
FT                   transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACA30998"
FT                   /db_xref="GOA:B0UVI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI8"
FT                   /protein_id="ACA30998.1"
FT                   /translation="MIKDYFLTIAQGIPTSLILTIVALLVAFFLALTLTFALSMEKKWL
FT                   SLPINLFLTIFTGTPLLVQFFLIYAGPGQFSWIVNSFLWPLLSSAWFCAILTLALNSTA
FT                   YSTQLFYGAVKAISKGQWESCVALGLSRWQTLKILVPYALKRALPSYSNEIILVFKGTS
FT                   LASIITILDIMGYARQLYGTEYDALTIYGIAGVIYLIITGIATLLLRRLERKVLVFERL
FT                   ETERV"
     atgattaaag attatttttt aacaattgca caaggaattc caacaagctt gattcttact        60
     atagttgcct tgttggtagc attttttctt gctttgacat taacttttgc tctttctatg       120
     gaaaaaaaat ggttaagtct tccaattaat ctttttctca caatttttac cggtacacca       180
     ttactggtgc aatttttctt aatctatgca ggaccgggac aattttcttg gattgtaaat       240
     agttttttat ggcctttatt atcaagtgcg tggttttgtg caatacttac attagcttta       300
     aatagtacag cgtattcaac tcagcttttt tatggtgcgg taaaagcgat ttctaaagga       360
     caatgggaaa gctgtgttgc actaggtttg agccgttggc aaactttgaa aattcttgtt       420
     ccttacgcat taaaaagagc attaccttca tatagcaatg aaataattct tgtttttaaa       480
     ggtacatcac ttgcttcaat tatcactatt ttggatatta tggggtatgc aagacaactt       540
     tatggtactg aatatgatgc actgacaatt tatggtatcg caggcgtaat ctatctcatt       600
     attacaggta ttgctacttt attattacgc agattggagc gtaaggtgct tgtatttgag       660
     cgtttagaaa cggagcgagt gtaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page