(data stored in ACNUC7421 zone)

EMBL: CP000947.PE126

CP000947.PE126       Location/Qualifiers
FT   CDS_pept        complement(137509..137796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31009"
FT                   /db_xref="InterPro:IPR020493"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVI9"
FT                   /protein_id="ACA31009.1"
FT                   /translation="MNIMLKPRSVMIILASVFATITTTHVQANTLPEQCQKLFKETENL
FT                   IAEAEKQPGTHVQLAKIKSKLKQSKQQILAMEHDIQIKSCDIGLAKLHTK"
     atgaatataa tgctaaaacc aagatcagta atgattattt tagctagcgt atttgcaact        60
     ataacaacaa ctcatgtcca agcaaacact ctgcctgagc agtgccaaaa attatttaaa       120
     gaaacagaaa atctaattgc tgaggcagaa aaacagccgg gaacacatgt tcaactggca       180
     aaaataaaaa gtaaattaaa acaaagtaag caacaaattc tcgccatgga gcatgatata       240
     caaatcaaaa gttgtgatat cggattggca aaacttcata cgaaatag                    288
//

If you have problems or comments...

PBIL Back to PBIL home page