(data stored in ACNUC7421 zone)

EMBL: CP000947.PE127

CP000947.PE127       Location/Qualifiers
FT   CDS_pept        138256..139821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0129"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: hso:HS_0256 cytochrome d ubiquinol oxidase, subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31020"
FT                   /db_xref="GOA:B0UVJ0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ0"
FT                   /protein_id="ACA31020.1"
FT                   /translation="MLDVVELSRLQFALTALYHFLFVPLTLGLSFILVIMETLYVATGK
FT                   EVYKDMTKFWGKLFGINFALGVTTGITMEFQFGTNWSYYSHYVGDIFGAPLAIEALLAF
FT                   FLESTFVGLFFFGWDRLSKAKHLLTTYCVAFGSNFSAMWILVANGWMQNPVASEFNFET
FT                   MRMEMTSFMDLWLNPVAQSKFLHTLSAGYVTSACFVLAISSYYLLKRRDVGFAKRSFSI
FT                   ASVFGIIATVSVLIMGDESGYEIGQTQPVKLAAMEGEWHTQPAPASWNMIVVPNQAEQK
FT                   NDFALQIPYAAGIIVTRSLDKQFTGLVDLQALNEQRVRNGMVAYGLLQQLKAEKKANGQ
FT                   VNEETKAQFNAVKDDLGFGLLLKRYTDAVVDATDEQVKQAAADTIPNVGPTFWSFRIMM
FT                   LAGGLILVLMIAAFVQNMRKTVGRSPLLLKALLWGLPLPWIAMESGWFLAEYGRQPWAI
FT                   YDVLPVGVAASNLTTADLWLSIGLICALYTIFLVVEMYLMFKYGRLGPSSLKTGRYYFE
FT                   QLSK"
     atgttggacg ttgttgaact ctctagattg cagtttgcgt taactgcgtt gtatcacttt        60
     ttgtttgtac cgctaacatt gggtttgtca tttatccttg tgattatgga aactttatat       120
     gttgcaacag gcaaagaagt gtataaagat atgaccaaat tctggggtaa attgtttggt       180
     attaattttg ccttaggcgt gacaactggg attacaatgg aattccaatt tggtactaac       240
     tggtcatact attctcatta tgttggtgat atttttgggg caccgctcgc tattgaagca       300
     ttacttgcat ttttcttaga atcaacattt gttggtttgt ttttctttgg atgggatcgt       360
     ttatcaaaag ctaaacattt attaactaca tattgtgtag catttggttc taacttttcg       420
     gccatgtgga ttttagttgc caatggctgg atgcaaaatc cggtagcgtc tgagtttaat       480
     tttgaaacaa tgcgtatgga aatgaccagt tttatggatc tttggttaaa ccctgttgca       540
     caaagtaaat tcttgcatac attgtctgcg ggttatgtga ctagtgcatg ttttgtttta       600
     gctattagtt catattacct cctaaaaaga cgtgatgtcg gattcgcaaa acgctctttc       660
     tctattgcat cagttttcgg tatcattgca actgtttcag tattgatcat gggtgatgaa       720
     tctggttacg aaattggtca aacccaacct gtaaaattag ctgctatgga aggtgaatgg       780
     catactcaac cggctcctgc gtcttggaat atgattgttg tacctaatca ggcagagcaa       840
     aaaaatgatt ttgctttaca aattccttat gctgcgggga ttattgttac tcgctcatta       900
     gacaaacaat ttacaggact agttgatcta caagctctta atgagcaacg agttcgtaac       960
     ggtatggttg cctatggttt actacaacaa ttgaaggctg agaaaaaggc caacggtcag      1020
     gttaatgaag aaactaaagc acaatttaac gcagttaaag atgacttagg atttggtcta      1080
     ttactcaagc gttatactga tgcggtcgta gatgcaactg atgagcaagt taagcaagca      1140
     gctgctgata ctatcccaaa tgtaggacca acgttttggt cattccgtat aatgatgctt      1200
     gccggtggtt taattctagt tctgatgatt gctgcattcg tacaaaatat gcgtaaaaca      1260
     gtagggcgta gtccactttt attaaaagct ttattatggg ggcttccact tccatggatt      1320
     gctatggaaa gtggttggtt cttagctgaa tatggacgtc aaccttgggc tatttatgat      1380
     gtactaccgg ttggtgtggc tgcgtcaaat ttaacaacag ctgatctttg gttatctatt      1440
     ggactgattt gtgccctcta tacaatcttc ctagtagtag aaatgtattt gatgtttaaa      1500
     tatggtcgct tgggtccgag ttcgttaaaa accggtcgtt attattttga acaattatct      1560
     aaataa                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page