(data stored in ACNUC7421 zone)

EMBL: CP000947.PE128

CP000947.PE128       Location/Qualifiers
FT   CDS_pept        139836..140972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0130"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="3.1.3.1"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   hso:HS_0257 cytochrome d ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31032"
FT                   /db_xref="GOA:B0UVJ1"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ1"
FT                   /protein_id="ACA31032.1"
FT                   /translation="MIDYEFLRFIWWILVGVLLIGFAVTDGFDMGVLSLLPFAGKKEVE
FT                   KRIMINSIAPHWDGNQVWLLTAGGAMFAAWPIVYAASFSGFYVAMILVLAALFFRPVGL
FT                   EYRAKIDNPTWRKFWDWGLFAGGFVPSLVFGVAFGNLLQGVPFEFNDLMQVTYTGSFFE
FT                   LLNPFAILCGLISFSMLTTQGAAWLQMKTTSELRERARVITQVGAFVTLLTFILAGVWL
FT                   YFKEGFIVTSVLDHNAPSDPTVKTVAVEVGAWFKNYFDAPVLFILPALAVGGALLNILA
FT                   SKANRSGFAFFFSSITMAGIILTCGVAMFPFVMPSISHPNMSLLMWDSTSSELTLTLML
FT                   GFALFFVVILLSYTIWAYAKMFGRLDADFIEENKNSLY"
     atgattgatt atgaatttct acgttttatt tggtggattt tagtcggggt actgcttatt        60
     ggatttgcag taacagacgg atttgatatg ggagttctta gcttattacc tttcgcaggc       120
     aaaaaagaag ttgagaaacg tataatgatc aattctatcg caccacattg ggatggaaac       180
     caagtttggt tattgactgc aggcggtgca atgtttgctg cttggccgat agtttatgca       240
     gcctctttct ccggctttta tgttgcgatg attttagttt tagccgcact atttttccgt       300
     cctgtcgggc tagagtatcg tgctaaaatt gataatccaa cttggcgtaa attttgggat       360
     tggggattat ttgctggtgg ttttgtccca tcattggtat tcggtgttgc attcggtaat       420
     ttattgcaag gtgttccatt tgaatttaat gatttgatgc aagtaactta tacaggttct       480
     ttctttgaat tattaaatcc ttttgcgatt ctttgtggtt taatcagttt ttctatgtta       540
     accacacaag gtgctgcttg gttacaaatg aaaacaacat cagaactgcg tgagcgtgct       600
     cgtgtaataa cacaagtagg tgcttttgtt acattgttga cgtttatttt ggctggtgtt       660
     tggttatatt tcaaagaagg ctttattgta acaagtgtcc ttgatcataa tgcaccatct       720
     gacccaactg ttaaaacagt tgcagttgaa gtgggagctt ggtttaagaa ttattttgat       780
     gcacctgtgt tgtttattct tccagcatta gcagtgggtg gtgcgttgtt aaatattttg       840
     gcatcaaaag ccaaccgttc aggatttgca tttttcttct cgtctatcac gatggcagga       900
     attatattaa cctgcggtgt tgccatgttc ccatttgtga tgccttctat ttctcatccg       960
     aatatgagtt tattaatgtg ggattcaaca tcaagtgaat taacattaac actaatgctt      1020
     ggttttgcac tgttctttgt tgttatttta ctgagctaca ccatttgggc ttatgcgaag      1080
     atgtttggtc gcttagatgc tgacttcatt gaagaaaaca aaaactcatt atactag         1137
//

If you have problems or comments...

PBIL Back to PBIL home page