(data stored in ACNUC7421 zone)

EMBL: CP000947.PE129

CP000947.PE129       Location/Qualifiers
FT   CDS_pept        141347..141772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0131"
FT                   /product="Pol-Pal system-associated acyl-CoA thioesterase"
FT                   /note="TIGRFAM: Pol-Pal system-associated acyl-CoA
FT                   thioesterase; PFAM: thioesterase superfamily protein; KEGG:
FT                   hso:HS_0258 possible thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31043"
FT                   /db_xref="GOA:B0UVJ2"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ2"
FT                   /protein_id="ACA31043.1"
FT                   /translation="MPVFKLPVRVYYEDTDAGGVVYHARYLHFFERARTEYLRTLNFSQ
FT                   QNLLNERKVAFVVKSMQIDYCVPAKLDDLLIVETYVVAIKGASIVFSQILKRDDEIISQ
FT                   AVVKVASVDLVKMRPVAIPQEIKAEIKLNDNIFGVMS"
     atgcctgttt ttaaattgcc tgttcgtgtg tattacgaag ataccgatgc cggaggtgtt        60
     gtttatcatg cccgttatct ccattttttt gaacgggcga gaacagaata cttgcgaacg       120
     ttgaattttt ctcagcaaaa cttattgaat gagcgaaaag ttgcttttgt tgtgaaatca       180
     atgcagattg actactgtgt tcctgcaaaa ttagatgacc tattaattgt ggaaacttat       240
     gttgtagcta tcaagggagc aagtatagtt ttttcacaaa tattgaaacg agatgatgag       300
     atcatttcac aagctgtggt gaaagttgcg tcagtggatc ttgtgaaaat gagacctgtg       360
     gctatacctc aagaaataaa agcagaaatt aaactaaatg ataacatttt cggagttatg       420
     tcatga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page