(data stored in ACNUC7421 zone)

EMBL: CP000947.PE13

CP000947.PE13        Location/Qualifiers
FT   CDS_pept        9638..11314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0013"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: hso:HS_0147 acetohydroxy acid
FT                   synthase II, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31031"
FT                   /db_xref="GOA:B0UUX1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX1"
FT                   /protein_id="ACA31031.1"
FT                   /translation="MNGANLVVECLKAHGVTSLFGYPGGAIMPVYDAIYDSGLDHLLCR
FT                   NEQGAAMAAIGYARSTNKVGVCVATSGPGATNLITGLGDALMDSIPIIAITGQVASNFI
FT                   GTDAFQEADILGLSLACTKHSFIVQHIDELPEIIAKAFQIAQSGRPGPVLIDLPKDVQF
FT                   APTSLKPIVYPKIADSLQNLVALEQAKNLLSQAKRPVLYVGGGVGMAKSSDGMSGVKAI
FT                   RTFLDITNIPSVSTLKGLGTIPPKHPLYMGMIGMHGTKAANYAVQECDLLIACGARFDD
FT                   RVTGKLDTFAPHAKVIHIDIDVAEINKLRKADVGLQGDLVEAVTNLAQLLDIEPWRKDI
FT                   EQLKASFDFNYIENTEDKEIEPCALLHTLSERKAKNAVITTDVGQHQMWSAQHMKHYEP
FT                   ENYITSAGFGSMGFGLPAAIGAAKARPQDPVILITGDGSLMMNIQELGSIKRGNLPIKI
FT                   LLLDNQRLGMVRQWQSLFFHGRHSHTVLDDNPDFVTLASAFGIAGERIEKASEVSDALD
FT                   RLLNAKEAYLLHVCIPDEENVWPLVPPNTCNSNMIEEDIGV"
     atgaatggag caaatttggt cgtagaatgt ttaaaagctc acggcgtaac ttccttattt        60
     ggctatcccg gtggggcgat aatgccagtt tatgatgcaa tttatgattc tggtttagat       120
     catctacttt gtcgtaatga gcaaggtgca gcaatggcgg ctattggata tgcaagatca       180
     acaaataaag tcggtgtttg tgttgcgacg tcgggaccgg gggcaacaaa tttaattacc       240
     ggtttaggtg atgccttgat ggattcaatt cccattattg caattaccgg acaagttgcc       300
     tcaaatttta tcggtacaga tgctttccag gaagctgata ttcttgggtt gtcacttgcc       360
     tgtactaagc acagttttat cgttcaacat attgatgaat tacctgaaat cattgcgaaa       420
     gctttccaaa ttgcacaaag tggtcgtcct ggtcctgtgc ttattgatct tccaaaagat       480
     gtgcaatttg cacctacatc cttaaaaccc attgtttatc ccaaaattgc ggattcttta       540
     caaaatttag tcgcacttga gcaagcgaaa aatttacttt ctcaagcaaa acgccctgtg       600
     ctttatgtag gtggcggtgt tggaatggca aaaagctcgg atggtatgag tggcgtaaaa       660
     gctatacgca cttttcttga tataacaaat attccatcag tatcaacctt aaaaggttta       720
     ggaacaatac ctcccaaaca tccactctat atgggaatga ttggaatgca cggtacaaaa       780
     gcggcaaatt atgctgtgca agaatgtgat ttacttattg cttgtggggc aaggtttgat       840
     gatcgtgtaa cgggaaaatt agatacgttt gcaccacatg ctaaagttat tcatattgat       900
     attgatgttg ctgaaattaa caaactccgt aaagcagatg ttggactaca aggggatttg       960
     gtggaggcgg ttactaacct tgcccaacta ttggatattg aaccgtggcg taaagatatt      1020
     gagcagttaa aagcaagttt tgattttaat tatattgaaa atacagaaga taaagagata      1080
     gagccctgtg cattacttca cacattatcc gaacgcaaag caaaaaatgc ggtgattaca      1140
     actgatgtag ggcaacatca aatgtggtcg gcacaacata tgaaacatta tgaacctgaa      1200
     aattatatta catctgcagg gttcggttcg atgggcttcg gtttgccggc agctatcggt      1260
     gcggcaaaag ctcgtcccca agatccagtt attttaatta ctggtgatgg ctcattgatg      1320
     atgaatattc aagaattggg ttcgatcaag cgtggaaatt taccaatcaa aattttattg      1380
     cttgataacc aacgtttggg tatggtgcga cagtggcaat cgctcttttt tcatggtcgc      1440
     catagccaca ctgttttaga tgataatcct gattttgtta ctcttgcttc tgcctttggt      1500
     attgcaggtg aacgaattga aaaggcaagt gaagtttccg atgctttgga tcgattatta      1560
     aatgccaaag aagcttattt actacatgtc tgtatcccag atgaagaaaa tgtatggcca      1620
     cttgtaccgc caaatacatg caacagtaat atgattgaag aagatattgg ggtgtaa         1677
//

If you have problems or comments...

PBIL Back to PBIL home page