(data stored in ACNUC7421 zone)

EMBL: CP000947.PE130

CP000947.PE130       Location/Qualifiers
FT   CDS_pept        141769..142452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0132"
FT                   /product="Tol-Pal system TolQ"
FT                   /note="TIGRFAM: Tol-Pal system TolQ; PFAM: MotA/TolQ/ExbB
FT                   proton channel; KEGG: hso:HS_0259 biopolymer transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31054"
FT                   /db_xref="GOA:B0UVJ3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ3"
FT                   /protein_id="ACA31054.1"
FT                   /translation="MTAELDFLELFLKASIVVQIVIVILISFSIISWAIIIQRSRILTR
FT                   ALKDSTLFEERFWSGEDLYKLYDGLSNRRNGLNSSERIFYVGFKEFNRLKQANPDAPEA
FT                   IIQGSSRAMNLTMNREVEDLETRVPFLATVASISPYIGLFGTVWGIMHAFMALSGAKQA
FT                   TLQMVAPGIAEALIATAIGLFAAIPAVMAYNRLSLRVNKLEQNYANFIDEFTTILHRQA
FT                   FGKNH"
     atgaccgctg aattagattt tttagaatta tttttaaagg ctagtattgt tgtacaaatt        60
     gtcattgtca tattaatatc tttttcgatt atatcttggg cgattattat ccaacgtagt       120
     cgcattttaa ctcgagcatt aaaggacagc acactttttg aagaacggtt ttggtctgga       180
     gaagatttgt ataaattata tgatggactt tctaatcgtc gtaatggtct aaatagcagt       240
     gagcgaattt tttatgttgg atttaaggag tttaatcgtc tgaaacaagc taatccggat       300
     gcccctgaag ccattattca aggcagttct agagcaatga atttaacaat gaatcgtgaa       360
     gtggaagatt tggaaacacg agttccgttt ttggcaactg ttgcgtctat tagtccatat       420
     atcggcttat ttggtacagt atggggaatt atgcatgctt ttatggcatt aagtggtgcc       480
     aaacaagcaa cattacagat ggttgccccg gggattgctg aggctttaat tgcaacggct       540
     attggtttat ttgctgctat tccagctgta atggcttaca atcgtttaag tctacgtgtg       600
     aataaattag agcaaaatta tgctaacttc attgatgaat ttacgacaat tttacatcgt       660
     caagcatttg gtaaaaatca ttaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page