(data stored in ACNUC7421 zone)

EMBL: CP000947.PE131

CP000947.PE131       Location/Qualifiers
FT   CDS_pept        142520..142942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0133"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   hso:HS_0260 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31065"
FT                   /db_xref="GOA:B0UVJ4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ4"
FT                   /protein_id="ACA31065.1"
FT                   /translation="MSYRRKRRDIKSEINIIPFLDVLLVLLLIFMATAPIISQSVQVEL
FT                   PEAVESQNVSKEDKTPVILEVSGIGQYALSIGGERTEGITEELVTQLSKQEFDKDNNTL
FT                   FLVGGAKDVPYEEVIKALNLLHVAGIKSVGLMTNPL"
     atgtcttatc gtcgaaaacg tcgagatatt aagtcagaaa ttaatattat tccttttttg        60
     gatgtcttat tggttttatt gctcattttt atggcaacag caccgattat tagtcagagt       120
     gttcaagttg aacttcccga agctgtagaa agccaaaatg tatctaaaga agataaaacg       180
     cctgttattt tggaggtttc aggtattgga cagtatgcac tttccattgg tggggagcga       240
     actgagggga taacagaaga attagtaact caactttcta agcaagaatt tgacaaagat       300
     aataacacgt tatttttggt tggaggggct aaagatgttc cgtatgagga ggtaatcaaa       360
     gctttgaatt tacttcatgt cgcgggaata aaatctgttg gattgatgac taatcctctt       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page