(data stored in ACNUC7421 zone)

EMBL: CP000947.PE132

CP000947.PE132       Location/Qualifiers
FT   CDS_pept        142961..144016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0134"
FT                   /product="Tol-Pal system TolA"
FT                   /note="TIGRFAM: Tol-Pal system TolA; PFAM: TolA family
FT                   protein; KEGG: hso:HS_0261 TolA protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31076"
FT                   /db_xref="GOA:B0UVJ5"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ5"
FT                   /protein_id="ACA31076.1"
FT                   /translation="MCNHRQKNELGAILLSIFLHILLLSLLVLGSNYNNVEIMGGGEGD
FT                   GEVMSAVMVDTGTIAKEWGRLQEKKKSNPDKQETFVEATQEDELMENVDVFEEKIREDE
FT                   DVQKRLAEQKIKEEKIQQERLAKQLEEDNAKKETVAKLKAEAEEMRLQALAKKIEEEKK
FT                   VRDAEEKQKVEKLAKERAEKLAKEKADRLAKQKALKEAKIKAEKAAKAKAELAQRKAEQ
FT                   AALDDFFNGGDIAGSSKNGGNMTMKGSQGVGAGFENGKGGRTGEQYAAQIKREIQRRFL
FT                   KEPRFANKVCVIEVELARDGTITNFRKLSGSDDICTAGLSAVSRTKKVPEAPTDEIYRK
FT                   YKKFPLEFRLK"
     gtgtgtaatc atcgacaaaa aaatgagctt ggtgccattc tgctatcaat ttttctgcat        60
     attttgttat taagtttgct ggtattagga tctaactata ataatgttga aatcatggga       120
     ggtggagaag gtgatggtga agtaatgtct gctgttatgg ttgatacggg aaccattgca       180
     aaagagtggg gacgtttaca ggaaaagaaa aaaagcaatc cggataaaca agaaaccttt       240
     gttgaagcaa cgcaagaaga cgagttaatg gagaatgttg atgtatttga agaaaaaata       300
     agagaagatg aagatgtaca gaaaagactt gcagagcaaa aaataaaaga agaaaaaatt       360
     cagcaagagc gtttagcaaa gcaattggaa gaagataatg ccaagaaaga gactgttgca       420
     aagttgaaag cagaggctga agaaatgcgt ttacaggcat tggcaaaaaa aattgaagaa       480
     gagaaaaagg ttagagacgc tgaggaaaaa caaaaagtag agaagttagc gaaagagaga       540
     gcagagaagt tagcaaaaga gaaagcggat agattagcca aacaaaaggc acttaaggaa       600
     gcaaaaataa aagcggaaaa agcggctaaa gcaaaagcgg aattagctca acgcaaagcg       660
     gaacaagcgg cgttagatga ttttttcaat ggaggtgata ttgcaggaag tagcaaaaat       720
     ggtggaaata tgacgatgaa aggttctcaa ggagtggggg ctggttttga aaacggcaaa       780
     ggcggaagaa ctggagagca atatgctgct caaattaaga gagaaattca gcgtcgcttt       840
     ctaaaagaac ctaggtttgc taataaagtt tgtgttattg aggttgaatt agcaagagat       900
     ggaacgatca ctaactttag aaaattatct ggctcagatg atatttgtac tgcggggtta       960
     tcagcggtat ctagaacgaa aaaggtaccg gaggcaccaa ctgatgagat ttatagaaaa      1020
     tataagaaat ttccactcga atttagattg aaataa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page