(data stored in ACNUC7421 zone)

EMBL: CP000947.PE133

CP000947.PE133       Location/Qualifiers
FT   CDS_pept        144044..145348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0135"
FT                   /product="Tol-Pal system beta propeller repeat TolB"
FT                   /note="TIGRFAM: Tol-Pal system beta propeller repeat TolB;
FT                   PFAM: TolB domain protein; WD40 domain protein beta
FT                   Propeller; KEGG: hso:HS_0262 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31085"
FT                   /db_xref="GOA:B0UVJ6"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVJ6"
FT                   /protein_id="ACA31085.1"
FT                   /translation="MKFSAYLTTLFIVLFSLFIQTVQAESEVRIVIDEGVDSARPIAII
FT                   PFKWNGSDSMPIDVADIISADLRNSGKFNPIAVSKMPQKPTSASEVISDVWSSLGIDAV
FT                   VVGQVTPNEKGYSIAYQLVDTIGASGNSGEVLSQNQYAVPKNAIRLGAHTISDEVFEKL
FT                   TAIRGAFRTKIAYVVQKNGGSKPYQVRIADYDGHNQFIVYSSSQPLMSPAWSPDGSKLA
FT                   YVSFENRKSQLIVHDLQSGARRVIAAFPGHNGAPAFSPDGSKIAFASSKDGVLNIYVMN
FT                   LGNGTISQLTSGAGNNTEPSWSPDGQSIIFTSDRAGGPQIYQMDVVGNGVSLVSAGRGY
FT                   SGKISADGSILVMIYGDNIVKKDLATGVTEMLSSTFLDESPSISPNGIMIIYSSTQGLG
FT                   KVLQLVSADGRFKARLPSSDGQIKFPAWSPYLNKN"
     atgaaatttt ctgcatattt aactacatta ttcatagtgc tttttagttt gttcatacaa        60
     accgtacaag ctgaaagtga ggtaagaatt gtcattgatg aaggggttga tagtgctcgg       120
     cctattgcga taattccatt taaatggaat ggtagtgact ctatgccgat agatgtagct       180
     gatatcattt ctgcagattt acgcaacagt ggtaaattta atcctattgc agtcagtaaa       240
     atgcctcaaa aaccgacatc agcaagtgag gtgatttccg atgtttggtc ttctttaggc       300
     attgatgcag tagttgttgg acaagttaca cccaatgaaa aaggatatag tatcgcatat       360
     caattagtag acactatcgg tgcttcagga aactcgggag aggtactaag tcaaaatcag       420
     tatgctgtac cgaaaaatgc tattcgttta ggtgctcata ccatcagtga tgaagttttt       480
     gaaaagctga ctgcaattcg tggtgcattt agaactaaaa ttgcatacgt tgtacaaaag       540
     aacggtggct caaaacctta tcaagttcgt attgcagatt atgatggaca taatcaattt       600
     attgtttata gtagttcgca accattgatg tctcccgctt ggtcgcctga tggtagtaaa       660
     ttggcttatg tatcttttga aaatcgtaaa tctcaattaa ttgtacatga tttacagtct       720
     ggagctcgtc gggttattgc tgcattccct gggcataatg gagctccggc attttctcct       780
     gatggttcaa aaatagcatt tgcttcatca aaagatggtg tactaaatat ttatgtcatg       840
     aatttaggaa acgggactat ttctcagttg actagcggtg caggcaacaa tacggaacct       900
     tcttggtcac cggatgggca atctataatt tttacttcgg acagagccgg cggacctcaa       960
     atttatcaga tggatgtagt tggtaatggt gtatcattag tttctgctgg tcgagggtat      1020
     agtggaaaaa tctctgcaga tggtagtata ttagtgatga tttatggcga taatattgtt      1080
     aaaaaagacc tggcgacagg tgtgacggaa atgttaagct ctactttctt agatgaaagc      1140
     ccaagtattt cacccaatgg aattatgatt atttatagtt ctacacaagg tctaggaaag      1200
     gtgctacaat tggtttccgc tgacggtcgt tttaaagcac gtctaccaag tagtgacggt      1260
     cagattaaat ttccagcttg gtcaccatat ttaaataaaa actag                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page