(data stored in ACNUC7421 zone)

EMBL: CP000947.PE134

CP000947.PE134       Location/Qualifiers
FT   CDS_pept        145358..145813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0136"
FT                   /product="Peptidoglycan-associated lipoprotein"
FT                   /note="TIGRFAM: Peptidoglycan-associated lipoprotein; PFAM:
FT                   OmpA/MotB domain protein; KEGG: hso:HS_0263
FT                   peptidoglycan-associated outer membrane lipoprotein (outer
FT                   membrane protein P6)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31096"
FT                   /db_xref="GOA:B0UVJ7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ7"
FT                   /protein_id="ACA31096.1"
FT                   /translation="MKNFAKLLVVAGSVAVLAACSSSDNASKTNAQMFGGYSVTDLQQR
FT                   YNTVYFEFDSYDVQGEYAQILDAHSAYLKSTPASKVLVEGHADERGTPEYNMALGLRRA
FT                   DAVKNFLLNKGVQASQLSTLSYGEEKPAELGHNEAAYSKNRRAVFAY"
     atgaaaaact ttgcaaaatt attagtagta gcgggttcag tggcagtatt ggcagcctgt        60
     agctcatctg ataacgcatc taaaacaaat gctcaaatgt ttggcggtta ttctgtaact       120
     gacttacaac aacgttataa tacagtatat tttgaatttg atagttatga tgtgcagggc       180
     gaatacgctc aaatcttaga tgcacactct gcatacttaa agtcaacacc agcttctaaa       240
     gttcttgttg aaggtcatgc tgatgaacgt ggtactccgg agtataacat ggcattaggt       300
     ttacgtcgtg ctgatgcagt aaaaaacttt ttattaaata agggtgttca agctagtcaa       360
     ctttcaaccc tttcttatgg tgaagagaaa ccggcagagt taggtcataa tgaagctgca       420
     tattctaaga accgtcgtgc tgtatttgca tactaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page