(data stored in ACNUC7421 zone)

EMBL: CP000947.PE136

CP000947.PE136       Location/Qualifiers
FT   CDS_pept        147028..147741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31118"
FT                   /db_xref="GOA:B0UVJ9"
FT                   /db_xref="InterPro:IPR016419"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVJ9"
FT                   /protein_id="ACA31118.1"
FT                   /translation="MIIYRGQTLLSVMIALSLSMMLLMSVSAFYSYSQQQNKQILLHLY
FT                   LQSELQRTIQLLGKDIRRSGFRAISDKLVRSNFDLFAQDKSGKSIVVAQADNEPPNSCV
FT                   LFIYDLDATGCVGTTYRNNVCVRNKQNTAREIERELFGYRLNKQMIETRLTYKNSISAN
FT                   CNQKQCQSYLQQPACNSGGWVDLLDENDIAITALKFNWIADYNGLEVYLKGHLKRNKQV
FT                   EYETSAIIPLLNQKR"
     ttgattattt atcgtggaca aactttatta agtgtaatga tagcgttgag cttatcaatg        60
     atgttattaa tgagtgttag tgcattttat agttatagtc agcaacaaaa taaacagata       120
     cttttgcatc tctatttaca atcagaattg caacgaacta tccaactttt gggtaaggat       180
     attcgccgta gtggatttag ggctattagt gataaattgg ttcggagtaa tttcgattta       240
     tttgcacaag ataaaagcgg aaagagtatt gtagtcgctc aagctgataa tgaacccccg       300
     aatagttgcg ttctttttat ttatgatctt gatgctaccg gctgtgtagg tacgacatat       360
     cgtaataatg tttgtgtaag gaataaacaa aatacagctc gtgaaattga gcgagagtta       420
     tttggttatc gcttaaataa acaaatgata gagacaagat taacttataa aaattcaatt       480
     agcgcgaatt gtaatcaaaa acaatgccaa agctatttac aacaacctgc atgtaatagc       540
     ggaggatggg tcgatttatt agatgaaaat gacatagcca taactgcatt aaaatttaat       600
     tggattgctg attacaatgg attggaagtt tatctaaaag ggcatctaaa gcgaaataaa       660
     caagtcgaat atgagacttc agccattatt cctttgctta atcaaaagag ataa             714
//

If you have problems or comments...

PBIL Back to PBIL home page