(data stored in ACNUC7421 zone)

EMBL: CP000947.PE137

CP000947.PE137       Location/Qualifiers
FT   CDS_pept        147744..148424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31129"
FT                   /db_xref="GOA:B0UVK0"
FT                   /db_xref="InterPro:IPR022543"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK0"
FT                   /protein_id="ACA31129.1"
FT                   /translation="MNIQKGVVTLTLLMLLSSVLLILLFFDGDLISLHSSIVSQRKIYL
FT                   EQSLILQRQSISQKEKLCENQPLNNNLKSLKIEFESRRKIDRTSQFIWCERKYLFKKRP
FT                   KKATYEAGLSQYINLELLDLFQHKLHSPPAILPRDKANYLYWVEEKSAELEIQGNINAV
FT                   VIAEGDLKLTGKGKISGTVITGGKLSIEPAVKIVYRSKTIIDLIRSYSYWQFAENSWYD
FT                   FQPL"
     atgaatatac aaaaaggagt tgtaacgctc accctattaa tgctgttaag ctcagtatta        60
     ttaattttac ttttttttga tggtgatttg atttcgttgc attcatccat tgtttctcaa       120
     cggaaaatat atttagaaca aagtcttata ttacagagac aaagtatttc tcaaaaagaa       180
     aaactttgtg aaaaccagcc tctgaataat aatttgaaaa gtttgaagat cgaatttgaa       240
     agtcgacgaa aaattgaccg cacttctcaa tttatatggt gtgaaagaaa atatttgttt       300
     aaaaaaaggc cgaaaaaagc tacttatgag gcagggctaa gtcagtatat aaatcttgag       360
     ttactggatt tatttcaaca taaattacat tcaccgcctg ctattttgcc gagagataaa       420
     gcaaattatc tctattgggt tgaggaaaaa tcagctgaat tggagataca aggtaatatt       480
     aatgcagttg ttattgctga aggggatttg aagttaacag gaaaaggtaa aattagtgga       540
     acggttatta ccggcgggaa attaagtatt gaaccagcag ttaaaattgt gtatcgctca       600
     aaaacaatca tcgatcttat ccgatcatat agttattggc agtttgcgga gaatagttgg       660
     tatgattttc aaccattata a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page