(data stored in ACNUC7421 zone)

EMBL: CP000947.PE138

CP000947.PE138       Location/Qualifiers
FT   CDS_pept        148405..148722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31141"
FT                   /db_xref="GOA:B0UVK1"
FT                   /db_xref="InterPro:IPR020511"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK1"
FT                   /protein_id="ACA31141.1"
FT                   /translation="MIFNHYKFPQRGTSLITLLVTMMIFSTLFLFVNQWVSYQRKSAVN
FT                   IYLRYQALQIAENQHQRLFLEPHFHCPHNIEQNGYKFKINCEGKNVRVSYANQQVNLLL
FT                   D"
     atgattttca accattataa atttcctcaa cggggtacca gcttgatcac gttattagtc        60
     acaatgatga tattttctac attattttta tttgttaatc aatgggttag ttatcaaaga       120
     aaaagtgcgg taaatattta tctacgttat caagctttgc aaatcgctga aaatcaacat       180
     caacgcttat ttctagaacc gcattttcat tgtccgcata atatcgagca aaatggttat       240
     aagtttaaga tcaattgtga aggtaagaat gtacgagttt cttatgcaaa tcaacaagta       300
     aatttattgc ttgattaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page