(data stored in ACNUC7421 zone)

EMBL: CP000947.PE139

CP000947.PE139       Location/Qualifiers
FT   CDS_pept        148775..152209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0141"
FT                   /product="exodeoxyribonuclease V, gamma subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease V, gamma subunit;
FT                   PFAM: Exodeoxyribonuclease V RecC subunit; KEGG:
FT                   hso:HS_0268 exodeoxyribonuclease V, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31152"
FT                   /db_xref="GOA:B0UVK2"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:B0UVK2"
FT                   /protein_id="ACA31152.1"
FT                   /translation="MFTLYYSNQLETQKDILLHLMDQQPLSDPFQKEVILVQSGGMAQW
FT                   IQWQIAEKKGISANLSFPMPASFIWQLYVDNLSQVTASSQFSKENMTWRLMEIIPHYID
FT                   QPEFYILRQYLQQSYQSSQQRYYQLASKIAELFDQYLVYRPEWIISWEQNKGVEIIQQI
FT                   QYYQKNLSVSESCFSQVEQHIVWQGILWRALVCSVQKETQKNVLHRAHLHLLFLKHIAG
FT                   EKPKNLPTRIFVFGISALPKVHLDTLSALSQHCDVHLFFNNACREYWGDIIDQSHWQRL
FT                   KVRERISWQDFQQPQNTQAWLSDAQIHTFEQNGFEQIYDEKLQVGNPLLSSWGKLGRDY
FT                   LYLLTELEANEINAYVELSEKTLLSQVQARILDLVPSKHKFLNLAENDRSLTFHSCYSP
FT                   IREVQALQDYLLHLFNQAQDLTPKDVVVMVADIDKYAPYIQAVFSQGEHYIPYSIADSK
FT                   LSENDPLVSAFLQLLNLKESLFSAEEVLTFLDHPVIRQSFNITLEDLAQIRHWVEHSGI
FT                   RFGLEKYPQQSLQNYNAWQAGLERMLLGFAMREENGLWLDTLGFDDTYGLKGQLVGYLK
FT                   DFITRLYQWHQFLQVDHVIEKWEEHLIELMSSFFVVDGMDIPQQYKTTFNYLIDTIQQL
FT                   TELILDSSFQQEISAEVIYEVFVERLKDIPNSLKFLMGKVTFCTLLPMRSIPFKVVCLL
FT                   GMNDSDYPRQQTPNSFDLMQYHRKKGDRFRRDDDRYLFLEALISAQQYFYVSYIGRSII
FT                   DDSEREPSVLVTQLLDYIAENINAQGDLKGQDILKKSLIQQHAMTAFSRENFTKRDRSF
FT                   SKQWLVLANKKDSGNLANFLQPINDTEIVKELSLNDLIAFIQDPVRYFFEQKLRVFLRK
FT                   TEQNIADTENFTLDNLELYQIKEELIYLSEQEWEDFFARMKIKGIMPQGAFAKIYQQKT
FT                   KNEIITLKSLVTPYLDQISEQIPVDLSVETEYGKVCLTGSIDSLYHQKMRRVTWRASVV
FT                   KTKDIIQTWIYYLLQTLVGEPNSQVEHYALDSRLSFEKIEKSTALQQLQTYVEAYLLGQ
FT                   VSVLLMPMKNFDQYLQLLFTPKSNKWKEEKDIDLSACFELLSELGSGRKERNFYVKTDP
FT                   YWQRILAQTKLDDSHILEINQRVIQWFDLMLMLKRVE"
     gtgtttactt tgtattattc caatcaattg gaaacgcaaa aagatatttt gttacattta        60
     atggatcaac agccattatc agatcctttc caaaaagaag ttattttagt acaaagtggc       120
     ggtatggcac agtggataca gtggcagatt gcagagaaaa aaggtatatc ggcaaatttg       180
     tcttttccta tgcctgcaag ttttatttgg caattatatg ttgataattt atcgcaagtc       240
     acagcttctt ctcaatttag taaagaaaat atgacttggc gattaatgga aattattccg       300
     cattatatag atcaaccgga attttacata ttgcgtcaat atttacagca aagttaccaa       360
     tcaagtcagc agcgatacta ccaattagcc agcaaaatag cagagttatt tgaccaatat       420
     ttagtttatc gaccggaatg gattataagt tgggagcaga ataaaggcgt agaaattatt       480
     cagcaaattc agtattacca aaaaaattta tctgtctcag aatcatgttt ttctcaagtt       540
     gagcaacata ttgtttggca aggtatttta tggagagctt tagtatgctc tgtgcaaaaa       600
     gaaacacaaa agaatgtttt acatcgtgca catttacatt tacttttctt aaaacatatt       660
     gccggcgaaa aacctaaaaa tttgcctacg agaatttttg tatttggtat ttcagcttta       720
     ccgaaggtgc atttagatac tttaagtgca ttaagccagc attgcgatgt gcatttattt       780
     tttaataatg cttgtcgtga atattgggga gatataattg atcagagcca ttggcaacgc       840
     ttgaaagtac gagagcgtat aagttggcaa gatttccaac aaccacaaaa tacacaggct       900
     tggttatccg atgcgcaaat acatactttt gaacaaaatg gatttgaaca aatttatgat       960
     gaaaagttac aggttggcaa tcctttgctt tcctcatggg gaaaattagg acgggattat      1020
     ttgtatttac tcactgaact ggaggctaat gaaatcaatg cttatgtcga actttcggaa      1080
     aaaacattgt tgtcgcaagt acaggcacgc attttagatt tggttccttc gaagcacaag      1140
     tttttaaatt tggcagaaaa tgaccgctct ttaacttttc attcttgtta tagtccaata      1200
     cgagaggttc aagctctaca agattatttg ttacatctat ttaaccaagc tcaggatttg      1260
     acacctaaag atgtggtagt tatggttgca gacattgata aatatgcacc gtatattcag      1320
     gcggtattca gtcaaggcga acactatatt ccgtactcta tcgcagacag caaactttcc      1380
     gaaaatgacc ctttagtatc tgctttttta cagctgttaa atttaaaaga aagtttattc      1440
     agtgcggagg aagtgctgac ttttttggat catcctgtta ttcgtcagag ttttaatatt      1500
     actttagagg atttggcaca aattcgtcat tgggttgagc attcgggtat tcgattcgga      1560
     ttagaaaaat atccgcaaca atccttgcaa aattataacg cttggcaggc aggtttagag      1620
     agaatgttac tgggatttgc tatgcgggaa gaaaatggtc tatggttaga tacgcttggc      1680
     tttgatgata cctatggatt aaaagggcag cttgtcggtt atttaaagga ttttattact      1740
     cgtttgtatc aatggcatca atttttgcaa gtagatcacg ttattgaaaa gtgggaagaa      1800
     catttaattg aattaatgtc atcttttttt gtggtagacg gaatggatat tccgcaacaa      1860
     tacaaaacaa cttttaatta tcttattgac actattcaac aattaacgga gttgatccta      1920
     gatagctctt ttcaacaaga aataagtgcg gaggttattt acgaagtttt tgttgaacgc      1980
     ttaaaagata tacccaatag cctaaaattt ttaatgggga aagtcacttt ttgtacgctt      2040
     ctccccatgc gatcaatccc ttttaaagtg gtgtgtttac ttggtatgaa tgatagtgat      2100
     tatccacgtc aacaaacacc gaacagcttt gatttaatgc aatatcatcg taaaaaaggc      2160
     gatcgttttc gccgagatga tgatcgctat ttatttttag aagcattgat ctcggcacaa      2220
     cagtattttt atgtgagtta tattggtcgc tctattattg atgatagtga acgagaacct      2280
     tcagttcttg ttacgcaatt gttggattat atagctgaaa atatcaatgc tcaaggtgat      2340
     ctaaaagggc aagatattct gaaaaaatca cttattcaac aacatgcgat gactgcattt      2400
     agccgagaaa atttcaccaa aagagaccgc tctttttcta agcaatggct agtgttggca      2460
     aataaaaaag atagtggcaa tttggcgaat tttttacagc cgataaatga tacagagata      2520
     gttaaagaac tttcattaaa tgacttaatt gcgtttattc aggatcctgt tcggtatttt      2580
     tttgagcaaa aattacgtgt ttttttacgt aagacagaac aaaatattgc ggatactgaa      2640
     aattttactt tagataattt agagttatat caaataaaag aagaacttat ttatctttct      2700
     gagcaggaat gggaagactt ttttgctcgg atgaaaatta agggaattat gccacaaggg      2760
     gcgtttgcaa aaatttatca gcaaaaaaca aaaaatgaga tcattacact taaatcttta      2820
     gttacgcctt atttggatca aatatcggaa caaattcctg ttgacttgag cgttgaaaca      2880
     gaatatggaa aagtatgctt aacggggagc attgacagtt tatatcatca aaaaatgcga      2940
     agagtaacgt ggagagcctc tgttgtcaaa acgaaagata ttatccaaac atggatttat      3000
     tatttattac aaaccttggt tggagagcct aattcgcaag ttgagcatta cgctttagac      3060
     agcagacttt cttttgaaaa aatagaaaaa tctaccgcac ttcaacagct tcaaacttat      3120
     gttgaggcat atttacttgg acaagtttca gtgttattaa tgccaatgaa aaatttcgat      3180
     caatatcttc aattgctttt tactccgaag agtaataaat ggaaagagga aaaggatatt      3240
     gatttatctg cttgttttga attgttatca gaacttggct caggtagaaa agagagaaat      3300
     ttttatgtga aaacagatcc ttattggcaa agaatattag cacaaacaaa actagacgat      3360
     tcacatattt tagaaattaa tcaacgtgtt atacaatggt tcgatttaat gttaatgcta      3420
     aaaagagttg aatag                                                       3435
//

If you have problems or comments...

PBIL Back to PBIL home page