(data stored in ACNUC7421 zone)

EMBL: CP000947.PE140

CP000947.PE140       Location/Qualifiers
FT   CDS_pept        152288..152902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0142"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA domain
FT                   I; SMART: Helix-hairpin-helix DNA-binding class 1; KEGG:
FT                   hso:HS_0269 Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31163"
FT                   /db_xref="GOA:B0UVK3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVK3"
FT                   /protein_id="ACA31163.1"
FT                   /translation="MIGRVTGILVEKQAPEILLDVQGVGYELLLPMTSFYNLPEVGQET
FT                   TLFTHFVVREDAHLLFGFSHKQDRSLFRELIKTNGVGPKLALAILSAMSVNEFVYAIEQ
FT                   EELSKLVKIPGVGKKTAERLLVELKGKFKGLQQTDFFIKSSHLPGIKCSKLDQSLQLDE
FT                   AVSALIALGYKPIEAEKMVKKVLKADLTSEQLIREALKAAL"
     atgattgggc gtgtaacagg aatactggtt gaaaaacaag ctccggaaat tttactggat        60
     gttcaaggtg ttgggtatga gttactttta cccatgacaa gtttttataa tttgccggaa       120
     gttgggcagg aaactacgtt gtttacgcat tttgtggtgc gtgaagatgc tcatttgtta       180
     tttggattta gccataaaca agaccgctct ttatttcgtg aattgattaa aaccaatgga       240
     gttggaccaa aattagcttt agctatcctg tctgcgatgt cagtgaatga atttgtgtat       300
     gcgattgaac aagaagaatt atctaaatta gtcaaaattc ccggagtagg aaaaaaaact       360
     gctgaacgtt tattggtgga gctaaaaggt aaatttaaag gcttacaaca aacagatttc       420
     tttattaaaa gctctcattt acctggaatt aaatgctcaa aactggatca aagtttgcag       480
     ttggatgaag cagtttctgc tttaattgcg ttaggatata agcctattga agcagagaaa       540
     atggttaaaa aagtgttaaa agcagattta actagtgaac agcttattcg agaggctttg       600
     aaagccgcat tataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page