(data stored in ACNUC7421 zone)

EMBL: CP000947.PE141

CP000947.PE141       Location/Qualifiers
FT   CDS_pept        152913..153920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0143"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; KEGG:
FT                   hso:HS_0270 Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31174"
FT                   /db_xref="GOA:B0UVK4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UVK4"
FT                   /protein_id="ACA31174.1"
FT                   /translation="MIEVDRIVSANAKVDDEYIDRAIRPKLLSDYIGQPQVREQMEIFI
FT                   QAAKLRQDALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSGPVLEKAGDLAAMLTNL
FT                   EPHDVLFIDEIHRLSPAIEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLIGATTR
FT                   AGSLTSPLRDRFGIVQRLEFYSVEDLASIVTRSAVCLQLEIDVEAGQEIACRSRGTPRI
FT                   ANRLLRRVRDYADVKNGGKITALIAQEALKMLDVDLAGFDFMDRKLLQAIIERFDGGPV
FT                   GLDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRIATSRTYRHFGLEQIEK"
     atgattgaag tagatcgcat tgtaagtgcc aatgcaaaag tagacgatga atatattgat        60
     cgtgcaattc gccctaaatt attgagtgat tatatcggtc aacctcaagt tagagagcaa       120
     atggaaattt tcatccaagc agcaaaatta cgccaagatg cacttgatca tttgttaatt       180
     tttggacccc ctggactagg aaaaacaacg ttggcgaata ttgttgccaa tgaaatggga       240
     gtgaatattc gtactacttc aggtccggtt ttagaaaaag cgggggattt ggcggcaatg       300
     ctaacgaatc ttgagcctca tgatgtatta ttcattgatg aaattcatcg cttatcacca       360
     gctattgagg aagttcttta tccagcgatg gaagattatc aactggatat tatgattgga       420
     gaaggtcctg ctgcccgttc aataaagctg gatttaccgc cttttacgct gattggagca       480
     acaacaagag caggctcttt gacttctcca ttacgagatc gattcggtat tgtgcagcga       540
     ctggagtttt attctgtaga ggatttagct tccattgtta ctcgaagtgc ggtctgtttg       600
     cagcttgaaa ttgatgttga agcaggacaa gaaattgctt gtcgttcacg aggtacccca       660
     cgtattgcaa atcgcctatt acgccgagtg cgagattatg ccgatgtcaa aaatggtggg       720
     aaaattaccg cacttattgc acaagaagca ctgaagatgc tggatgtgga tcttgcagga       780
     tttgatttta tggatcgtaa attattacag gcaattattg agcggtttga tggtggacct       840
     gtaggattgg ataatttggc ggcggcaatt ggcgaagagc gagataccat tgaagatgta       900
     ttggagcctt atttaattca gcaaggattt ttacaacgga cacctcgtgg aagaatagca       960
     acatcaagaa cttatcgaca ttttggtttg gaacagattg aaaaatag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page